Bharat Padhe - Details of online lessons

Please log in

Name of the FacultySubjectClassTopicConducted DateNo. of Students EnrolledNo. of Students Attended% of Students attendedNo. of Students
attended full session
% of Students
attended full session
Methodology adoptedEvidence
M.Vijaya LakshmiEnglishMPC n Home scienceEarth democracy2024-08-20585810058100Whatsapp You Tube Vidieo Click Here
Y.NagarathnammaBotanyIII BZC(TM)Plasmalemma2023-11-202012601260Lecture methodClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Sex linked inheritance 2021-12-024035953595Video lesson shared through WhatsApp Click Here
Y.NagarathnammaBotanyIII BZC(TM)DNA Double Helix structure2021-11-202013651365Lecture method with pptClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Sex linked inheritance 2021-01-023825923892Video lesson shared through WhatsApp groupClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Sex linked inheritance 2021-01-023825923892Video lesson shared through WhatsApp groupClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Sex linked inheritance 2021-01-023825923892Video lesson shared through WhatsApp groupClick Here
U.Venkateswarlu ZoologyM.Sc Final Concept behind classification of fishes.2020-12-3125416416Google MeetClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Sex linked inheritance 2020-12-304030903090Video lesson shared through watts app group Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendelian deviations 2020-12-303025952595Video lesson shared through WhatsApp groupClick Here
U.Venkateswarlu ZoologyM.Sc FinalStudy hour on Classification of fishes.2020-12-3025936728Google MeetClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Sex linked inheritance 2020-12-292826982698Video lesson shared through WhatsApp Click Here
U.Venkateswarlu ZoologyM.Sc FinalTypes of Scales in fishes.2020-12-292510401040Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Macrophytes / Large aquatic plants.2020-12-2825936832Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalAssessment of performance in Mid-semester exams.2020-12-2625832624Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalConducted mid exam – Limnology.2020-12-232513521352Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalReview of Limnology for Mid semester exam.2020-12-22251560624Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalMid semester Examination – Ichthyology.2020-12-212514561456Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalStudy hour and preparation for Ichthyology.2020-12-202511441144Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Review of Dissolved Oxygen and Nitrogen cycle for mid exams.2020-12-19251040636Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Review of the topics Thermal stratification and Factors affecting light penetration for mid exams.2020-12-182512481248Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalStudy hour and preparation for mid exams. Respiratory and Circulatory systems in fishes.2020-12-17251144416Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalModel test conducted on Anomalous properties of water.2020-12-162512481248Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest on Skin of Fishes and Evaluation.2020-12-142510401352Google MeetClick Here
Dr S L B SANKARA SARMASanskritIII Semesterभवभूतिमहाकविः2020-12-1312067566556CiscowebexClick Here
Dr S L B SANKARA SARMASanskritIII Semesterअनन्वयालङ्कारः।2020-12-1212065566456CiscowebexClick Here
U.Venkateswarlu ZoologyM.Sc FinalBenthos ---- Classification, Types and distribution.2020-12-122510401040Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest on Plankton and assessment of the answers.2020-12-112512481248Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalConducted an elocution on different social problems including Human rights.2020-12-1025936936Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Significance of Nekton in Food chain.2020-12-0925416416Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalInternal test on Nitrogen cycle and evaluation.2020-12-0925832936Google MeetClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology tRNA2020-12-081813721372Lecture discussion through Google meet & whiteboardClick Here
J. KavithaMathematicsV semMaximal and prime ideals2020-12-087952665266Google meetClick Here
U.Venkateswarlu ZoologyM.Sc FinalEcological importance of the Plankton.2020-12-0825525525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalStructure and functions of skin in fishes.2020-12-072515601352Google MeetClick Here
Anusha KChemistryIII sem B.Screvision on SN1 SN2-Halogen compounds2020-12-054937753775google meetClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology-RNA types- m RNA2020-12-0538821.05821.05Lecture method through Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalBio-mass variability of plankton and significance of plankton to fishes.2020-12-052516641664Google MeetClick Here
Anusha KChemistryIII sem B.ScSN1 SN2-Halogen compounds2020-12-044928572857google meetClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology-RNA types2020-12-0424625625Lecture method through Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalAfrican, Neotropical and Oriental regions.2020-12-0425525525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Types of Plankton and its distribution.2020-12-042514561560Google MeetClick Here
Anusha KChemistryIII sem B.ScActive methylene compounds-synthetic applications2020-12-034928572857googlemeetClick Here
B.Vijaya rekhaZoologyM.Sc finallimitation of microbial growth by nutrient supply2020-12-0325624624google meetClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology-RNA types2020-12-0338821.5821.5Lecture method through Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalZoogeographical Realms with reference to the distribution of the Fresh water fishes. 2020-12-0325728525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalMajor groups of Fresh water fishes and their distribution.2020-12-032512481560Google MeetClick Here
Anusha KChemistryIII sem B.ScActive methylene compounds-preparation and hydrolysis2020-12-024932653265googlemeetClick Here
B.Vijaya rekhaZoologyM.Sc finalmicrobial nutrition2020-12-02258321248google meetClick Here
U.Venkateswarlu ZoologyM.Sc Final English language skills to write the exams. 2020-12-0225525525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalZoogeography of F.W fishes. 2020-12-022514561456Google MeetClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology : Splicing2020-12-011812671267Discussion & Explanation with Google meeet Click Here
Anusha KChemistryIII sem B.ScActive methylene compounds-ketoenol tautomerism2020-12-014928572857googlemeetClick Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Genomic and cDNA LIBRARY2020-12-01382668.422668.42Google class room .Lecture notes sharingClick Here
B.Vijaya rekhaZoologyM.Sc finalsuperficial mycoses2020-12-012510401040google meetClick Here
U.Venkateswarlu ZoologyM.Sc Final Online Classes- Students’ attitude and discipline.2020-12-0125520520Google meetClick Here
U.Venkateswarlu ZoologyM.Sc Final MeetClick Here
Anusha KChemistryIII sem B.ScMetal carbonyls EAN CLASSIFICAION STRUCTURES2020-11-304928572857GOOGLEMEETClick Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Polymerase chain reaction2020-11-30382668.422668.42GOOGLE CLASS ROOM-NOTES AND ASSIGNMENTClick Here
U.Venkateswarlu ZoologyM.Sc FinalGonado somatic index in fishes.2020-11-3025624520Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalHormones in fishes. Conducted a test and Evaluation of the answers.2020-11-302510401040Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearspectral problems2020-11-301311881188zoom app sharing pptClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology: 5'Capping & 3' poly A tail2020-11-301812671267Explanation & discussion through Google meetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearspectral problems2020-11-291312901290zoom app sharing video and pptClick Here
U.Venkateswarlu ZoologyM.Sc FinalAbout Genome Project.2020-11-2825525525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalEndocrine glands in fishes.2020-11-2825728624Google MeetClick Here
Anusha KChemistryIII sem B.ScMetal carbonyls Ferrocene2020-11-284935713571googlemeetClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearSpectral problems2020-11-281310881088Zoom meeting by sharing pdfClick Here
U.Venkateswarlu ZoologyM.Sc FinalVirus and its Mutations in view of corona.2020-11-2725525525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest conducted on factors affecting penetration of light.2020-11-2725416416Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearastructure and synthesis of lysergic acid and synthesis of ergotamine2020-11-271311881188zoom app sharing pptClick Here
D.Vijaya SreeBiochemistryIII Bsc Biochemistry B4,B6Mechanism of glucocorticoid2020-11-271813731373class in zoom appClick Here
Anusha KCHEMISTRY III SEM B.Sc.Theories of bonding in metals band theory2020-11-274921432143googlemeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Zoogeography of fishes.2020-11-2625416416Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalExcretory, Nervous and Reproductive systems in general.2020-11-2625525525Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearstructural elucidation of Ergotamine2020-11-261311891189zoom app sharing ppClick Here
D.Vijaya SreeBiochemistryIII Bsc Biochemistry Mechanism of harmone action2020-11-2618950950class in zoom meetings appClick Here
D.Vijaya SreeBiochemistryII nd year Bsc biochemistryprinciple of paper chromatography2020-11-263514401440class in zoom meetings appClick Here
Anusha KCHEMISTRY III SEM B.Sc.Theories of bonding in metals free electronTheory2020-11-264918371837google meetClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology-DNA as genetic material2020-11-26381026.311026.31Lecture method through Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc Final Ionic regulation in fishes.2020-11-2525525525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalBrief account on digestive, respiratory and blood vascular systems.2020-11-2525728728Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearsynthesis of yohimbine and spectral problems2020-11-251310881088zoom app by sharing pptClick Here
B DorkaBiochemistryIII BSc BiochemTranscription mechanism discussion2020-11-251810571057Discussion through Google meet with Youtube assistanceClick Here
Anusha KCHEMISTRY III SEM B.Sc.Theories of bonding in metals VBT2020-11-254922452245GOOGLE MEETClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology - RNA Types2020-11-2524937.5937.5Lecture method through Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc Final Identities of Inland waters. Productivity of a lake.2020-11-2425936728Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest conducted on Reproductive structures. Evaluation and discussion of the answers.2020-11-24251040832Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearsynthesis of reserpine structural elucidation of yohimbine2020-11-2413970970zoom app sharing pptClick Here
B DorkaBiochemistryIII BSc BiochemRNA pol discussion Q & A2020-11-241812671267Discussion through G-meetClick Here
D.Vijaya SreeBiochemistryII nd year Bsc biochemistryintroduction to chromatography2020-11-243521602160class in zoom appClick Here
Anusha KCHEMISTRY III SEM B.Sc.Carbonyl compounds unit IV2020-11-244928572857googlemeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearstructural elucidation of Reserpine2020-11-231312901290zoom app sharing video and notesClick Here
D Vijaya SreeBiochemistryII nd Bsc biochemistrysummary of centrifugation2020-11-233815401540zoom appClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics2020-11-234114391439Black boardClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology RNA pol Discussion2020-11-2318739739Google meet discussion with youtubeClick Here
N Rajya LakshmiComputer ScienceIII BComSructure of C Program2020-11-23565610056100Google classroomClick Here
Anusha KCHEMISTRY III SEM B.Sc.Carbonyl compounds unit IV2020-11-234823472347googlemeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Clarification of general doubts regarding the subject.2020-11-22252828Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearspectral problems2020-11-2213970970zoom app by sharing videoClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearassignment on alkalods2020-11-211310701070zoom appClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology Mechanism of Transcription2020-11-21181810018100Lesson premiered through YoutubeClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology-DNA as Genetic material2020-11-21381744.74174744Lecture method through Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalEnglish medium tips for Telugu medium students.2020-11-2025624416Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest conducted on Thermal stratification. Evaluation & discussion of the answers submitted by the students.2020-11-2025525416Google MeetClick Here
D. Krishna priyaHomescienceII bsc homescienceHousing needs in different stages of family life cycle2020-11-202817611761ZoomClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- DNA Replication2020-11-20241666.671666.67LE CTURE METHOD through ZOOM app using ppt Click Here
Dr. g.padmini deviHomescience III B.Sc. H.scfactors influencing rate of adoption2020-11-20241770.31770.3cisco webexClick Here
Y.NagarathnammaBotanyIII BZC(TM)DNA genetic material2020-11-202013651313Lecture method Click Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearrearangemeent of morphene to morphol , morphene to apomorphene and bio synthesis of alkalods2020-11-201310701070zoom appClick Here
D.Vijaya SreeBIO CHEMISTRYIII BSC BIO CHEM B4,B6organisation of harmones2020-11-201810561056zoomClick Here
U.Venkateswarlu ZoologyM.Sc FinalTeaching the English medium skills for Telugu medium students. 2020-11-1925636636Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Significance of Mitotic divisions. Significance of Miotic division.2020-11-1925525525Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearrearrangement of thebine to thebenine , structural elucidation by using all spectral data2020-11-191311881188zoom appClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology-DNA Replication2020-11-19381539.471539.47Lecture method through Zoom app -using DNA Replication pptClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Universal gates2020-11-198052645163CISCO WebExClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6Harmones2020-11-191811611161zoom meetings Click Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology - Basic Rules of Transcription _ Promoters , ...2020-11-19181810018100Lesson through Youtube telecastClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearmulti step synthesis , synthesis of para bromo benzanilide2020-11-18131310013100zoom app by sharing pptClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- DNA Structure2020-11-182412501250Lecture method using ppt DNA structure through Zoom AppClick Here
Dundi Krishna priyaHomescienceIII B. ScIntroduction to ECCE2020-11-18241979.171770.83Cisco webexClick Here
B.Vijaya rekhaZoologyM.Sc finalsewage and its types, treatment of domestic sewage2020-11-182512481560google meetClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Logic gates2020-11-188050635063CISCO WebExClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology- RNA Pol Pro & Eukaryotic2020-11-18181810018100Lecture through YoutubeClick Here
U.Venkateswarlu ZoologyM.Sc FinalA test has been conducted on circulatory system. Evaluation of the answers.2020-11-1825936832G MeetClick Here
M venkataramanaCommerceIII bcom generalTender2020-11-175013261326WebEx meeting appClick Here
N.DivyasriCommerceIII GeneralSoil erosion and conservation2020-11-175017341734Explanation through webexClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearstructure and synthesis of morphiene2020-11-171311881188zoom appClick Here
Dr.Ch.Bhaskara RaoBotany3 rd BSC,BZC -C1 SectionDNA Structure2020-11-174020502059Lecture method using ppt on Strucure of DNAClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Self induction of long solenoid2020-11-178051636163CISCO WebEx qClick Here
U.Venkateswarlu ZoologyM.Sc FinalStructure of the Heart in fishes Function of the Heart in fishes.2020-11-17256361040Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalArterial system in fishes. Venous system in fishes.2020-11-172510401144MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearindole alkaloids introduction and structural elucidaton of emetine2020-11-1613750750zoom appClick Here
M venkataramanaCost accountingIII bcom generalTender2020-11-165015301530WebEx meeting appClick Here
M venkataramanaCommerceIII bcom generalRural and farm credit2020-11-165014281428WebEx meeting appClick Here
N.DivyasriCommerceIII GeneralIndia Agriculture2020-11-16131310013100Explanation through webexClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Faraday laws2020-11-168051635163Cisco WebExClick Here
U.Venkateswarlu ZoologyM.Sc FinalImportance of English medium for competitive exams and future prospectus.2020-11-162510401144Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearAssignment on proton NMR spectra2020-11-1513544544zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalDiscussion on the answers given by the students.2020-11-14251040832Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearnuclear over houser effect , integration on proton NMR spectra2020-11-131310881088zoom appClick Here
Anusha KCHEMISTRY III SEM B.Sc.Carbonyl compounds unit IV2020-11-1310234333433GooglemeetClick Here
Dr Latha BChemistryII BSc A1, B3, B4, B6Physical properties and preparation methods of phenol2020-11-137942534253Cisco WebExClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest conducted on Anomalous properties of water. 2020-11-1325832832Google MeetClick Here
Latha BGCWII BSc A1, B3, B4, B6Hydroboration and Grignard addition for the preparation of alcohols2020-11-127936453645Cisco WebEx AppClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology- Basic Rules of Transcription2020-11-1218633633Lecture explanation in Google meet with WhiteboardClick Here
Anusha KCHEMISTRY III SEM B.Sc.Carbonyl compounds unit IV2020-11-1210221202120GOOGLE MEETClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Joule Kelvin cooling2020-11-12772937.662937.66Webex app ppt presentationClick Here
U.Venkateswarlu ZoologyM.Sc Final Various physiological activities in brief. Different embryonic stages in brief.2020-11-1225624416Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yeartemperature dependent NMR Spectroscopy2020-11-121310881088zoom appClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearIdentification of structure of unknown compounds using proton nmr spectroscopy2020-11-1113750750zoom appClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamic scale of temperature2020-11-11772633.772633.77Webex appClick Here
Latha BGCWII BSc A1, B3, B4, B6Synthesis of Alcihols2020-11-11793949.33949.3Cisco WebEx AppClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest conducted on Respiratory system in fishes. Evaluation and discussion on the answers given by the students.2020-11-1125525728Google MeetClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Digging--poem2020-11-1030113711100ZoomClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearinterpretation of chemical shifts in proton nmr cs values2020-11-101311881188through zoom appClick Here
U.Venkateswarlu ZoologyM.Sc Final Summary of Organizational levels. Contd the organizational levels in Animal kingdom.2020-11-1025728832Google MeetClick Here
Latha BGCWII BSc A1, B3, B4, B6Hydroxy Compounds2020-11-097937463746Cisco WebexClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsPotus plug experiment 2020-11-09772936.772936.77Webex app ppt Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)De Morgan's laws and logic gates2020-11-098565766576Google classroomClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearDynamic proton NMR DEUTERIUM EXCHANGE METHODS2020-11-091311881188through zoom app by sharing pptClick Here
U.Venkateswarlu ZoologyM.Sc Final Types of Symmetry and Body cavity.,Importance of education in woman’s life.2020-11-0925728728Google meetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearsimplification of complex spectra into first order spectra2020-11-081312921292zoom meeting by sharing pptClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearsimplification of non first to first order spectra2020-11-071312921292zoom app by sharing pptClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Once upon a time_poem2020-11-07309309100ZoomClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Half adder & full adder2020-11-078072907290Whatsapp PPT sharingClick Here
U.Venkateswarlu ZoologyM.Sc Final Fundamentals of zoology. Ethics and Human values.2020-11-0725312312Google MeetClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology : Transcription RNA pol2020-11-0619842842Lecture Explanation with Whiteboard on Google meetClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Once upon a time_poem2020-11-0630186018100Zoom appClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)De Morgan's laws, nand & nor gates2020-11-068072907290Whatsapp ppt sharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearchemical shift problems spin spin interactions to first order spectra2020-11-061311881188zoom app by sharing pptClick Here
U.Venkateswarlu ZoologyM.Sc FinalRole of Co2 in chemical buffering. Significance of 7.4 PH in blood.2020-11-0625624624Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearstereo chemistry of phenanthrene alkaloids2020-11-051310771077zoom app Click Here
B DorkaBiochemistryIII BSc BiochemTranscription Introduction2020-11-0519842842Lecture Discussion through whiteboard & Google meetClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Logic gates2020-11-05727210072100WhatsappClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Shyness,Myshield2020-11-0530144614100Zoom appClick Here
D. Krishna PriyaHome scienceII bscFactors influencing selection of site2020-11-042817611761ZoomClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearstereo chemistry of cinchona alkaloids2020-11-041310771077zoom app sharing pptClick Here
B DorkaBiochemistryIII BSc BiochemReplication Revision & College reopening details with COVID safety 2020-11-0419947947Google meet - Lecture discussionClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsLow temperature physics2020-11-04772431.172431.17Webex app PPT PRESENTATION Click Here
U.Venkateswarlu ZoologyM.Sc Final A test has been conducted on chemical buffering. Discussion on the answers written in a test.2020-11-0425936624Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final PH scale vs H+ ion concentration. 2020-11-0425312312Google meetClick Here
D. Krishna PriyaHome scienceIII bscStatus of ECE during pregnancy and post independence period2020-11-032817611761ZoomClick Here
U.Venkateswarlu ZoologyM.Sc Final what is life? various biochemical reactions in protoplasm. 2020-11-0325936832Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalFundamentals & concept Orientation of zoology.2020-11-02251040728Google MeetClick Here
D. Krishna PriyaHome scienceII bscHousing and interior decoration quiz2020-10-312820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-312317701770Google formsClick Here
U.Venkateswarlu ZoologyM.Sc FinalOviparity in Marine and F.W fishes with examples. Ovo-Viviparity and Viviparity in fishes with examples.2020-10-3125728728Google meetClick Here
U.Venkateswarlu ZoologyM.Sc FinalParental care in fishes. 2020-10-3125520624Google MeetClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-302317701770Google formsClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearclassification of NMR spectra2020-10-3013870870zoom app by using pptClick Here
Latha BGCWII BSc A1, B3, B4, B6SN Reactions2020-10-307938483848Cisco WebEx APpClick Here
U.Venkateswarlu ZoologyM.Sc Final Reproductive structures in Teleosts. Discussion on Maturity of Gonads in general.2020-10-3025728624Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalMaturity stages of female gonads in fishes. Gonadosomatic Index (GSI) and Fecundity in fishes.2020-10-3025525525Google MeetClick Here
D. Krishna PriyaHome scienceII bscHousing and interior decoration quiz2020-10-292820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-292317701770Google formsClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearsin spin interactions coupling constants types of coupling constant 2020-10-2913761861zolom meeting by sharing pptClick Here
Latha BGCWII BSc A1, B3, B4, B6Classification and Reactivity of Halogen Compounds2020-10-297934433443Cisco WebEx AppClick Here
U.Venkateswarlu ZoologyM.Sc Final Phosphorous cycle. Shared the study material for the topics covered in ichthyology.2020-10-2925728525Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalT.S of Testis and Ovary in fishes. Reproductive structures in Elasmobranchs.2020-10-2925832728Google MeetClick Here
D. Krishna PriyaHomescienceIII bscEcce2020-10-282820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-282315701570Google formsClick Here
Latha BGCWII BSc A1, B3, B4, B6Halogen Compounds2020-10-28653749.33749.3Cisco WebExClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearchemical shift factors effecting chemical shift 2020-10-281310881088zoom meeting by sharing pptClick Here
U.Venkateswarlu ZoologyM.Sc FinalRole of CO2 in chemical buffering. Bicarbonate buffering system in blood.2020-10-2825624520Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Nitrogen cycle. 2020-10-2825525525Google MeetClick Here
D. Krishna PriyaHome scienceIII bscEcce quiz2020-10-272820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-272319901990Google formsClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearImportant terminologies in NMR SPECTROSCOPY2020-10-271311881188zoom meetingClick Here
U.Venkateswarlu ZoologyM.Sc Final A video on chemical buffering has been presented. Discussion on chemical buffering.2020-10-2725728832Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc FinalWhy is PH important in animals? Reasons for natural variations in PH.2020-10-27251040832Google MeetClick Here
D. Krishna PriyaHome scienceIII bscEcce bits2020-10-262820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-262315601560Google formsClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearIntroduction and basic principle of NMR Spectroscopy2020-10-261310881088Zoom meetingClick Here
U.Venkateswarlu ZoologyM.Sc Final Review on 2nd semester examinations. Sharing the materials (notes) for the topics covered. 2020-10-2625936728Google MeetClick Here
U.Venkateswarlu ZoologyM.Sc Final Acidic, Basic and Buffer solutions. Importance of PH for smooth functioning of life processes.2020-10-2625728520Google MeetClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-252315551555Google formsClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-242316601660Google formsClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearStructural elucidation by using IR spectra2020-10-241310881088Zoom meeting by sharing pptClick Here
D. Krishna PriyaHomescienceIII bscEcce2020-10-232820712071Google formClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearInterior station of inorganic compounds by using IR Spectra2020-10-231310881088Zoom meeting Click Here
Anusha KarumurichemistryB.Sc. IIIsemF-BLOCK separation of lanthanides2020-10-2310228272827google meetClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- Chromosome-Solenoid model2020-10-232412501250Lecturer method through Zoom meeting using ppt ChromosomesClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceGoogle quiz on nutrition2020-10-232319701970Google formsClick Here
D. Krishna PriyaHomescienceIII bscEcce bits2020-10-222820712071Google formClick Here
Anusha KarumurichemistryB.Sc. IIIsemf-block2020-10-2210236352726lectureClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearIR sestra vibrational frequency ,factors effecting vibrational frequency in inorganic compounds2020-10-2213750750Zoon meeting by sharing pptClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearinterpretatin of ESR Spectra2020-10-2113750750zoom meeting sharing pptClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology, viruses 2020-10-213815401540Google meet Click Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceOnline quiz on nutrition2020-10-212317701770Google formsClick Here
D. Krishna PriyaHome scienceIII bscEcce quiz2020-10-202820712071Google formClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology2020-10-203826722672Video lesson shared through WhatsApp group Click Here
Dr S J M PRATHAP KUMARZoologyIII MZC BiZCIndigenous cattle breeds2020-10-2030826.67826.67Google meet PowerPoint presentation sharedClick Here
B.Swetha Rani BaiBakery and confectionary III B.Sc Home sciencePractical orientation classe2020-10-202316781575Zoom meetingsClick Here
D. Krishna PriyaHome scienceII bscHousing and interior decoration2020-10-192820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceCommunity nutrition bits 2020-10-192321952195Google formsClick Here
B.Swetha Rani BaiBakery and confectionary III B.Sc Home scienceRheological prosperities2020-10-172313551355Zoom meetingsClick Here
D. Krishna PriyaHome scienceIII bscEarly childhood care and education2020-10-172820712071Google formClick Here
D. Krishna PriyaHome scienceIIbscHousing and interior decoration quiz2020-10-172820712071Google formClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceCommunication skills for dietitian2020-10-162314551455Zoom meetingsClick Here
D. Krishna PriyaHome scienceII bscHousing and interior decoration2020-10-162820712071Google formClick Here
U.Venkateswarlu ZoologyM.Sc Final Revision Hormonal regulation in reproduction. Revision Moulting and Metamorph2020-10-152511441144Google MeetClick Here
B.Swetha Rani BaiTherapeutic nutrition bitsIII B.Sc Home scienceBits quiz2020-10-152317701770Google formsClick Here
D. Krishna PriyaHome scienceIII bscEcce quiz2020-10-152820712071Google formClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearelectron spin resonance spectroscopy of organic compounds2020-10-141311881188zoom meeting by screen shareClick Here
U.Venkateswarlu ZoologyM.Sc FinalRevision Hardy-Weinberg Law of Equilibrium. Revision Convergent and Divergent Evolution.2020-10-1425832636Google MeetClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceNutrition care process2020-10-142315551555Zoom meetingClick Here
D. Krishna PriyaHome scienceII bscHousing and interior decoration quiz2020-10-142820712071Google formClick Here
U.Venkateswarlu ZoologyM.Sc FinalRevision Inborn errors of metabolism. Revision Chromosomal abnormalities.2020-10-132510401040Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearelectron spin resonance spectroscopy selection rule and principle2020-10-131310701070zoom meetingClick Here
B.Swetha Rani BaiBakery and confectionary III B.Sc Home scienceTypes of flours2020-10-132314551455Zoom meetingsClick Here
D. Krishna PriyaHomescienceIII bscEcce quiz2020-10-132820712071Google form Click Here
U.Venkateswarlu ZoologyM.Sc FinalRevision Propagation of Nerve Impulse. Revision Synaptic transmission.2020-10-12251040936Google MeetClick Here
B.SucharithaChemistryM.SC II YearFlow methods,Relaxation methods,Flash photolysis2020-10-1213862862Zoom App Screen SharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearinterpretation of IR values to inorganic compounds2020-10-1213850850zoom meetingClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceRole of dietitian2020-10-122315601560Zoom meetingsClick Here
D. Krishna PriyaHomescienceII bscHousing and interior decoration quiz2020-10-122820712071Google formClick Here
U.Venkateswarlu ZoologyM.Sc FinalRevision Blood group Inheritance. Revision Concept of Eugenics.2020-10-11251040624Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearassignment2020-10-111311881188zoom meetingClick Here
B.SucharithaChemistryM.SC II YearCorrosion,Fuel Cells2020-10-1113539539Zoom App Screen SharingClick Here
B.Vijaya rekhaZoologyM.Sc finalnutrition impairment and stress,plague disease diagnosis and its control2020-10-112510401040Google meetClick Here
U.Venkateswarlu ZoologyM.Sc Final Revision Sex determination. Revision Sex-Linked Inheritance.2020-10-102510401040Google MeetClick Here
B.Vijaya rekhaZoologyM.Sc finaltuberculosis2020-10-10257281040Google meetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearinterpretatin of IR spectra 2020-10-101311881188zoom meetingClick Here
B.SucharithaChemistryM.SC II YearUV -Polyatomic molecuies2020-10-101310771077Zoom App Screen SharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearinterpretation of IR values to organic compounds2020-10-091310701070zoom meetingClick Here
U.Venkateswarlu ZoologyM.Sc FinalRevision Human Genome Project. Revision Pedigree Analysis.2020-10-092513521040Google MeetClick Here
B.SucharithaChemistryM.SC II YearUv Rotational Fine Structure2020-10-0913539539Zoom App Screen SharingClick Here
U.Venkateswarlu ZoologyM.Sc Final Path ways of cellular metabolism revised. Notes prepared and shared.2020-10-082515601248Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearcomparisons of ir values with examples2020-10-0813861861zoom meetibg Click Here
B.SucharithaChemistryM.SC II YearUV-Vibrational Coarse structure2020-10-0813431431Zoom App Screen SharingClick Here
U.Venkateswarlu ZoologyM.Sc FinalProcess of digestion and absorption. Notes prepared and shared.2020-10-072512481040Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearinterpretatin of IR spectra 2020-10-0713861861zoom meetingClick Here
B.SucharithaChemistryM.SC II YearIR-Anharmonic oscillator2020-10-0713539539Zoom App Screen SharingClick Here
U.Venkateswarlu ZoologyM.Sc FinalBehavioral genetics in Drosophila. Behavioral genetics in Bees.2020-10-062512481040Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearreactions of organometallic compounds2020-10-061311881188zoom meetingClick Here
B.SucharithaChemistryM.SC II YearIR -SHO2020-10-0613754646Zoom App screen sharingClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceBits quiz2020-10-062419701970Google formsClick Here
U.Venkateswarlu ZoologyM.Sc FinalSources and Losses of Co2 in lake waters. Distribution patterns of co2 in lake waters.2020-10-052512481248Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearvibrational frequency of amines nitro compounds 1 3 di ketones2020-10-051310851085by lecture method using screen sharing through zoom meetingClick Here
B.SucharithaChemistryM.SC II YearKempferol Constitution,synthesis,Stereochemistry2020-10-0513862862ZoomApp Screen SharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearassignment2020-10-041311881188through zoom meetingClick Here
B.SucharithaChemistryM.SC II YearESR spectra H.,CH3.,BSQ2020-10-0413646539Zoom App Screen sharingClick Here
U.Venkateswarlu ZoologyM.Sc FinalVideos on muscle contraction are presented. Muscle contraction, sliding filament theory.2020-10-0325525525Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearvibrational frequency of ether carbonyl compounds and amides2020-10-031311881188zoom meetingClick Here
B.SucharithaChemistryM.SC II YearQuercetin Constitution,Synthesis2020-10-0313754754Zoom App Screen SharingClick Here
U.Venkateswarlu ZoologyM.Sc Final Functions of the muscles. Structure of Actin and Myosin filaments.2020-10-0225728525Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearvibrational frequency of anhydrides, acids and esters2020-10-021311881188zoom meetingClick Here
B.SucharithaChemistryM.SC II YearFlavanoids2020-10-021312921292Zoom App screen sharingClick Here
U.Venkateswarlu ZoologyM.Sc FinalStriated, Non striated and Cardiac Muscle fibers. Ultra structure of the striated muscle. 2020-10-0125636636Google MeetClick Here
B.SucharithaChemistryM.SC II YearESR Hyperfine splitting2020-10-0113646539Zoom App Screen SharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearAssignment on named reactions2020-10-011311881188through zoom meetingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearAssignment 32020-09-3013750750zoom meetingClick Here
U.Venkateswarlu ZoologyM.Sc FinalO2 depletion problems in fish ponds. Control mechanisms of O2 depletion in fish ponds.2020-09-3025936624Google MeetClick Here
B.SucharithaChemistryM.SC II YearNMR Spin Spin coupling examples2020-09-3013646539Zoom App Screen sharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearEnergy profile diagram and mechanism of substitution reactions SN1 &SN2 reactions2020-09-2913750750Through zoom meeting by lecture methodClick Here
U.Venkateswarlu ZoologyM.Sc FinalSources & Losses of D.O in aquatic environments. Distribution patterns of D.O in aquatic environment.2020-09-29251040832Google MeetClick Here
B.SucharithaChemistryM.SC II YearNMR Spin Spin coupling examples2020-09-2913539539Zoom App screen sharingClick Here
U.Venkateswarlu ZoologyM.Sc Final Two Videos on Dissolved Oxygen have been presented. Relationship between dissolved oxygen and aquatic life.2020-09-2825936832Google MeetClick Here
B.SucharithaChemistryM.SC II YearNMR Spin Spin coupling2020-09-2813431431Zoom App screen sharingClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearstructural elucidation of atropiene camphor and berberine2020-09-2813750750zoom meetClick Here
U.Venkateswarlu ZoologyM.Sc FinalFunctions of the Brain in fishes. Test on “Structure and functions of the brain in fishes” has been conducted in goggle f2020-09-26251040832Google MeetClick Here
Y.LakshmiPrasannaChemistry M.Sc chemistry II yearnamed reactions and mechanisms part 42020-09-2613539539zoom meetingClick Here
B.SucharithaChemistryM.SC II YearMW Spectra Rigid rotator DAM2020-09-2613431431Zoom App screen SharingClick Here
B.Swetha Rani BaiBakery and confectionary III B.Sc Home scienceMaintenance of equipment2020-09-262315701570Zoom meetingsClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearfactors effecting substitution reactions2020-09-2513539539zoom meetingClick Here
U.Venkateswarlu ZoologyM.Sc FinalBrain Structure in detail. Structure of the brain in Elasmobranchs. 2020-09-252514561248google meetClick Here
U.Venkateswarlu ZoologyM.Sc FinalStructure of the brain in elasmobranchs contd. Structure of the brain in Teleosts.2020-09-2525832832Google MeetClick Here
B.SucharithaChemistryM.SC II YearEnergy of molecules,Types of spectra2020-09-2513646431Zoom App screen sharingClick Here
B.Swetha Rani BaiBakery and confectionary III B.Sc Home scienceMaintenance of equipment2020-09-252317701770Zoom meetingsClick Here
B.SucharithaChemistryM.SC II YearTerpinoids Biosynthesis2020-09-2413862754Zoom app Screen sharingClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearprotection of acids alcohols carboxylic acids2020-09-2413744744zoom appClick Here
B.Swetha Rani BaiBakery and confectionary III B.Sc Home scienceEquipment classification2020-09-242313551355Zoom meetingsClick Here
U.Venkateswarlu ZoologyM.Sc FinalDuplicate genes, modifier genes. Cumulative genes, Lethal genes.2020-09-232511441144google meetClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearprotecting groups part 22020-09-2313861861by lecture method through zoom appClick Here
M venkataramanaCommerceII bcom generalIncome from other sources2020-09-235030603060Material send to whatsapp groupClick Here
B.SucharithaChemistryM.SC II YearTerpinoids Biosynthesis2020-09-2313646539Zoom App screen sharingClick Here
B.Swetha Rani BaiHome science III B.Sc Home scienceEquipment classification2020-09-232315601560Zoom meetingsClick Here
D. Krishna PriyaHomescienceII bscTypes of house2020-09-232415631563ZoomClick Here
U.Venkateswarlu ZoologyM.Sc Final Recessive Epistasis with example. Dominant Epistasis with example.2020-09-2225832832Google MeetClick Here
M venkataramanaCommerceII bcom generalIncome from salary2020-09-225015301530Coscx WebEx meeting app and material send to whatsapp groupClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearElimination reactions2020-09-2213539539by lecture method through zoom appClick Here
B.SucharithaChemistryM.SC II YearTerpenoids,Abietic acid Constitution2020-09-2213646646Zoom App screen sharingClick Here
D. Krishna PriyaHome scienceII bscHousing and interior decoration quiz2020-09-212820712071Google formClick Here
U.Venkateswarlu ZoologyM.Sc Final Interaction of genes Complementary genes, Supplementary genes.2020-09-2125832832Google MeetClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearalkaloids2020-09-2113861861By lecture methodClick Here
B.SucharithaChemistryM.SC II YearTerpenoids,Abietic acid Constitution2020-09-2113539539ZOOM APP screen sharingClick Here
M venkataramanaCommerceII bcom generalDeduction 80c to 80u2020-09-215016321632Coscx WebEx meeting appClick Here
U.Venkateswarlu ZoologyM.Sc Finalactors affecting Light penetration into natural waters Continuation of the above said Topic.2020-09-19251144936Google MeetClick Here
B.Swetha Rani BaiHome science III B.Sc Home scienceSmall equipment2020-09-192315601560Zoom web meetingsClick Here
M venkataramanaCommerceII bcom generalTotal income2020-09-195011221122Coscx WebEx meeting appClick Here
U.Venkateswarlu ZoologyM.Sc Final Thermal Classification of Lakes Thermal Classification of Lakes contd. 2020-09-182512481248Google MeetClick Here
M venkataramanaCommerceII bcom generalTotal income2020-09-185010201020Coscx WebEx meetingClick Here
D. Krishna PriyaHomescienceIII bscNeed for ece centres2020-09-182415631563ZoomClick Here
U.Venkateswarlu ZoologyM.Sc FinalWinter Stagnation, Spring Overturn, Summer Stratification and Fall Overturn.Overall Impact of Thermal stratification on Plants a2020-09-172513521352Google MeetClick Here
M venkataramanaCommerceII bcom generalTotal income2020-09-175019381938Coscx WebEx meeting appClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearanalysis of mixture, elimination of interfering anion less femiliar cations2020-09-1713870970by lecture methodClick Here
B.SucharithaChemistryM.SC II YearTerpenoids,Eudesmol Constitution2020-09-171311851185Zoom App Screen SharingClick Here
U.Venkateswarlu ZoologyM.Sc Final Thermal Stratification Introduction.A video on Thermal Stratification has been presented. 2020-09-162510401040Google MeetClick Here
B.SucharithaChemistryM.SC II YearTerpenoids,Santonin Constitution2020-09-1613539431ZoomApp--Screen sharingClick Here
M venkataramanaCommerceI Bcom Computer BankingDepreciation2020-09-165030603060Material send to whatsapp groupClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearprotecting groups2020-09-1613544544by lecture methodClick Here
U.Venkateswarlu ZoologyM.Sc Final Heart in Elasmobranchs and in TeleostsArterial and Venous systems in Elasmobranchs and Teleosts.2020-09-152512481248google meetClick Here
G.sitaElectronicsII B.ScGray Code Conversion2020-09-15301033.31033.3Zoom AppClick Here
G.sitaElectronicsIII B.Scpower in AM wave2020-09-152512481248zoom appClick Here
M venkataramanaCommerceI Bcom Computer & BankingDepreciation2020-09-155040804080Material send to whatsapp groupClick Here
B.SucharithaChemistryM.SC II YearTerpenoids,Zinziberine Constitution2020-09-1513862754ZoomApp meeting---ScreensharingClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearorgel and ts diadrams and term symbols2020-09-1513861861by lecture method through zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalQ & A to Students Ethical Values and Morals 2020-09-142515601248google meetClick Here
G.sitaElectronicsII B.ScLogic Gates2020-09-143012401240Zoom AppClick Here
B.SucharithaChemistryM.SC II YearTerpenoids,Isoprene rule,Classification2020-09-1413754539Zoom App meeting screen sharingClick Here
M venkataramanaCommerceII bcom computerfunction of RBI2020-09-145030603060PPT sent to whatsapp groupClick Here
Dr. Venkateswara Rao BodepudiHindiAllHindi Day Celebration2020-09-14151510015100Jio Meet Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearnamed reactions and mechanisms part 32020-09-1413750750by lecture methodClick Here
D. Krishna PriyaHome scienceII bscTerms related to housing2020-09-142415631573ZoomClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsAssignment exam2020-09-137767.867.8Webex app and Google Classroom Click Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearnamed reactions and mechanisms part 22020-09-1313861861by lecture method through zoom meeting using pptClick Here
G.sitaElectronicsII B.ScOctal,hexadecimal conversions2020-09-123011361136Zoom appClick Here
B.SucharithaChemistryM.SC II YearTerpinoids Sources,Isolation2020-09-1213431431ZOOM APP Screen sharingClick Here
Y.LakshmiPrasannachemistry M.Sc chemistry II yearnamed reactions and mechanisms2020-09-1213861861by lecture method through zoom meetingClick Here
D. Krishna PriyaHomescienceIII BscIntroduction to ECCE2020-09-122415631563ZoomClick Here
U.Venkateswarlu ZoologyM.Sc FinalOne Video has been presented on Mendel’s LawsOne Video has been presented on a fish heart and explained.2020-09-122512481248Google MeetClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearelectronic spectroscopy2020-09-1113750750lecture method through zoom meetingClick Here
M venkataramanaCommerceII bcom generalSelf occupied for HP2020-09-115019381938Coscx WebEx meeting appClick Here
M venkataramanaCommerceII bcom generalRTI act2020-09-115020402040PPT sent to whatsapp groupClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides Rotenoids--22020-09-1113431431ZOOM APP SCREEN SHAREClick Here
G.sitaElectronicsIII B.ScSide band frequency of AM2020-09-112512481248zoom appClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceIntroduction to diet counseling2020-09-112414701470PowerPoint presentationClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceIntroduction to diet counseling2020-09-112414701470PowerPoint presentationClick Here
D. Krishna PriyaHomescienceII bscIntroduction to housing2020-09-112415636363ZoomClick Here
U.Venkateswarlu ZoologyM.Sc FinalPituitary gland, Thyroid and Adreno cortical tissue in fishes.chromaffin tissue, Corpuscles of Stannious, Ultimo branchial gland2020-09-112514561456Google MeetClick Here
B DorkaBiochemistryIII BSc BiochemElongation & Termination of Replication2020-09-1018844.5844.5Lecture Discussion through Google meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsAssignment exam2020-09-10772329.92329.9Webex app and Google Classroom Click Here
M venkataramanaCommerceII bcom generalPre contraction interest HP2020-09-105020402040Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceI Bcom Computer BankingDepreciation2020-09-105034683468Coscx WebEx meeting appClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides Rotenoids2020-09-1013431323zoom app ---screen sharingClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearcotton effect faraday effect2020-09-1013750750lecture method through zoom meetingClick Here
G.sitaElectronicsII B.ScConversion of Number Systems form one form to another form2020-09-103011361136zoom appClick Here
G.sitaElectronicsIII B.ScAnalysis of AM2020-09-102510401040Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalSpecific heat, Latent heat, Surface tension etc, of water.Anomalous expansion and contraction of water, it’s influence on Biot2020-09-102510401040google meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsSpecific heat relations2020-09-09771823.371823.37Webex appClick Here
M venkataramanaCommerceII bcom generalHouse property2020-09-095020402040Coscx WebEx meeting appClick Here
M venkataramanaCommerceII bcom generalAgreement2020-09-095020402040Coscx WebEx meeting app and material send to whatsapp groupClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides Pachyrrhizin,Anonaine2020-09-0913539431-Zoom App screen share---Lecture methodClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearOrganic named reactions 2020-09-0913750750Lecture method using zoom meetingClick Here
G.sitaElectronicsIII B.ScNumber System in Digital Electronics2020-09-093011361136Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc Final Anomalous properties of water, Structure of water molecule. Cohesion and Adhesion, It’s influence on biota in Inland waters.2020-09-092510401040google meetClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-09-085022442244Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-09-085029582958Coscx WebEx meeting appClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides Spilanthol2020-09-0813646646Zoom app screen sharing--Lecture ethodClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Material for electromagnetic induction2020-09-087563846384Google classroomClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearelectronic spectroscopy2020-09-0813750750through zoom meeting by lecture methodClick Here
B DorkaBiochemistryIII BSc BiochemInitiation of Replication2020-09-081811611161Lecture Discussion through Google MeetClick Here
G.sitaElectronicsIII B.ScNeed for modulation2020-09-082512481248Zoom appClick Here
U.Venkateswarlu ZoologyM.Sc FinalTest conducted in Google form on 8-9-2020 2-4.30pm Test Conducted on 8-9-2020 2-4.30 pm2020-09-0825520520google meetClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearCoupling interactions and orgel diagrams2020-09-071310901090Lecture method using zoom meetingClick Here
Rohini PEnglish2nd bsc b1to b6The Beloved Charioteer2020-09-078381998199WhatsAppClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-09-075021422142Coscx WebEx meeting app and material send to whatsapp groupClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides Anacylin2020-09-0713646646Zoom App screen sharing -Lecture methodClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-09-075033663366Coscx WebEx meeting app and material send to whatsapp groupClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics2020-09-073817473817Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology2020-09-072811451145Google meet Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Faraday laws2020-09-077570937093WhatsappClick Here
B DorkaBiochemistryIII BSc BiochemProteins & Enzymes; Basic rules of replication2020-09-0718844.5844.5Lecture Discussion through Google meetClick Here
RohiniEnglish2nd bsc b1to b6The Beloved Charioteer2020-09-079190999099WhatsAppClick Here
U.Venkateswarlu ZoologyM.Sc Final Explanation of all physiological activities including Metabolism. Role of water in all the physiological activities in animals2020-09-0725832832google meetClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- Structure of chromosome2020-09-062412501250Lecturer method using ppt through Zoom AppClick Here
D. Vijaya SreeBiochemistryII, III B3, B4, B6small millets to a large population - guest lecture of GDC-Kukatpally2020-09-055828484848zoom cloud meetingClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearVibrational frequency of phenols, esters and ethers2020-09-051310901090Lecture method by zoom meetingClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vantillu2020-09-05381642.11642.1Lecture method through zoom appClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Chromosomes notes given2020-09-053828732873WhatsApp group Click Here
M venkataramanaCommerceIII bcom generalCost sheet2020-09-055015301530Coscx WebEx meeting appClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean (less than series)2020-09-055024482448Coscx WebEx meeting appClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides jasmolin---22020-09-0513754754Zoom App Screen share--lecture methodClick Here
Latha BChemistryII BSc A1, B3, B4, B6Actinide contraction and comparision of Lanthandes and Actinides2020-09-05673856.73856.7Cisco WebEx meetClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Problems2020-09-057563846384Google classroomClick Here
D.Krishna PriyaHome scienceI, II, III B. ScArticle writing on role of proteins in immunity, strategies to combat food insecurity, holistic nutrition during covid2020-09-05101010100100GmailClick Here
U.Venkateswarlu ZoologyM.Sc FinalStructure of the Nephron in detail Function of the kidney or Urine formation in fishes2020-09-052512481248google meetClick Here
Dr. Venkateswara Rao BodepudiHindiHindi III Semesterकाव्यदीप - मातृभूमि - मैथिलीशरण गुप्त2020-09-046915221493Jio meet Click Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology- Structure of Chromosomes2020-09-04382052.632052.63Lecturer method using PPt through Zoom AppClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides jasmolin---12020-09-04131077862Zoom app screensharing -- Lecture method Assignment --2Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel deviations2020-09-043824652465Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel deviations2020-09-042813471347Google meet Click Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearVibrational frequency of alcohols ,acids and carbonyl compounds2020-09-041310901090By lecture method through Zoom meetingClick Here
B DorkaBiochemistryIII BSc BiochemDNA ligase mechanism of Action2020-09-04181055.51055.5Lecture Discussion through Google meetClick Here
G.sitaElectronicsIII B.ScIntroduction to AM2020-09-042511441144Zoom appClick Here
D. Krishna PriyaHomescienceI, II, III B. scNutrition guidelines for covid 19 patients, itks of foods during pandemic situation, lifestyle practices to fight with covid192020-09-041010100100100GmailClick Here
U.Venkateswarlu ZoologyM.Sc FinalStructure of the kidney, various types of kidneys in fishes A brief discussion on Nephrons and their function.2020-09-042510401040google meetClick Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam2020-09-0350501004998Cisco WebexClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-09-035022442244Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-09-035024482448Coscx WebEx meeting appClick Here
K Aparna SeetharamChemistryV semister final yearsRemidial class on organic chemistry Hydrocarbons2020-09-0312057495749ICT zoomClick Here
M.Kamala KarunachemistryIII B.Scamino acids2020-09-03452248.82248.8zoom meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsApplications of maxwells relations2020-09-03773545.453545.46Ppt presentation webex appClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Telugu Bhasha2020-09-03381642.11642.1Lecture method through Zoom appClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yeariR spectroscopy2020-09-0313750750by lecture method through zoom meetingClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides CINERIN -22020-09-0313539539ZOOMAPP screen sharing --Lecture methodClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel deviations2020-09-033823602360Google meet Click Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6f-block elements Sudents seminar2020-09-03674161.24161.2Cisco WebEx MeetClick Here
Dr.G.Swarna LathaTelugu3rd BASHTAndhramu putupoorvataralu2020-09-0314642.86642.86Zoom meetingClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Problems2020-09-037548634662Cisco WebEx problem solvingClick Here
G.sitaElectronicsII B.ScSyllabus explained2020-09-03301033.31033.3Zoom appClick Here
G.sitaElectronicsIII B.ScSyllabus explained2020-09-032513521353Zoom appClick Here
D. Krishna PriyaHome scienceI, II, III B. ScArticle writing on role of proteins in immunity, immune boosters in every day foods2020-09-0310101010100Zoom GmailClick Here
U.Venkateswarlu ZoologyM.Sc FinalExcretory Organs in fishes ppt presented Excretory Organs Q & A (oral)2020-09-032512481248google meetClick Here
Dr.G. Padmini DeviHomescience III B.Sc. H.Sc.barriers in communication 2020-09-02231773.911773.91zoomClick Here
Anusha KarumurichemistryB.Sc. IIIsemcarbonyl compounds2020-09-0210242414241googlemeetClick Here
Dr.G.Swarna LathaTelugu3rd BASHTAndhramu putupoorvataralu2020-09-0214637.5637.5Zoom meetingClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yeartypes of peaks in ir spectra and characteristic vibrational frequencies of hydrocarbons2020-09-0213985985zoom meeting by lecture methodClick Here
B DorkaBiochemistryIII BSc BiochemMOLBIO DNA Polymerases2020-09-021812671267Lecture Discussion through Google meetClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-09-025020402040Coscx WebEx meeting appClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-09-025030603060Coscx WebEx meeting app and material send to whatsapp groupClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsMaxwell's thermodynamic relations2020-09-02773646.73646.7Ppt presentation via webex appClick Here
Naga Prasanna. MZoology III MZC & BiZC Southern and northern blotting techniques2020-09-02361438.881130.55Google meetClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Telugu Bhasha2020-09-02381744.731744.73Lecture method through Zoom appClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology exam through google form2020-09-023815471547Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2viruses exam2020-09-022812471247Google meet Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Electric potential and equipotential surfaces2020-09-027572967296WhatsappClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides Cinerin--12020-09-0213646539ZOOM APP Screensharing--- Lecture methodClick Here
Latha BChemistryII BSc A1, B3, B4, B6f- block elements student seminar on Lanthanide contraction and its consequences2020-09-02674668.64668.6Cisco WebEx meetClick Here
D. Vijaya SreeBiochemistryII B3, B4, B6analytical centrifugation2020-09-024016404040zoom cloud meetingClick Here
J kavithaMathematicsV semTheorems on ideals2020-09-02140621406245Google meetClick Here
D. Krishna PriyaHomescienceI, II, III B. ScArticle writing on role of water healthy body, ITKs of foods during pandemic situation2020-09-021010100100100GmailClick Here
U.Venkateswarlu ZoologyM.Sc Final Classification of lakes Evolution of Urino- genital System (Pro, Meso and Meta nephros)2020-09-022512481248google meetClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-09-015021422142Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-09-015031623162Coscx WebEx meeting app and material send to whatsapp groupClick Here
B DorkaBiochemistryIII BSc BiochemProperties of DNA pol2020-09-0118950950Lecture discussion through Google meetClick Here
Naga Prasanna. MZoology III MZC & BiZC PCR and its applications2020-09-01361747.21438.8google meetClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Telugu Bhasha2020-09-01381436.841436.84Lecture method through zoom appClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring InsecticidesPYRETHRIN--22020-09-0113862754ZOOM APP SCREEN SHARE----Lecture methodClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearassignment on uv spectra2020-09-0113750750zoom meeting and whatsappClick Here
Anusha KarumurichemistryB.Sc. IIIsemcarbonyl compounds2020-09-0110239383938googlemeetClick Here
Dr.G.Swarna LathaTelugu3rd BASHTAndhramu putupoorvataralu2020-09-0114637.5637.5Zoom meetingClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Electric potential and equipotential surfaces2020-09-017544584256Cisco WebExClick Here
Latha BChemistryII BSc A1, B3, B4, B6Student seminars on Lanthanide Electronic configuration and Oxidation states2020-09-01674161.24161.2Cisco WebEx MeetClick Here
D. Krishna PriyaHomescienceIII B. scNutrition and immunity2020-09-01108808080Gmail google ClassroomClick Here
D. Krishna PriyaHomescienceII B.Sc &I B. scArticle writing on strategies to combat food insecurity due to covid, immune boosters in every day foods2020-09-011010100100100GmailClick Here
U.Venkateswarlu ZoologyM.Sc FinalOrigin of Lakes2020-09-012515601560Google MeetClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-315018361836Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-315039783978Coscx WebEx meeting app and material send to whatsapp groupClick Here
B DorkaBiochemistryIII BSc BiochemReplication - Overview2020-08-3118950950Lecture - Discussion through ZoomClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Telugu Bhasha2020-08-31381744.731744.73Lecture method through Zoom appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)praacheenaandhra padya saasanalu - Telugu basha sahityalu2020-08-311312901290online class through zoomClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Maxwell's equations2020-08-31772532.42431.16Webex appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)praacheenaandhra padya saasanalu - Telugu basha sahityalu2020-08-311312901290online class through zoomClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides pyrethrolone 2020-08-3113646646zoomapp screen sharing ---Lecture methodClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Applications of Gauss law2020-08-317550674560Cisco WebExClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearmock test on cinchonal alkaloids2020-08-3113970970zoom meetingClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearassignment 2020-08-311311851185through whatsapp Click Here
Latha BChemistryII BSc A1, B3, B4, B6About JKC-TCS iON skill course "Career Edge - Knockdown the Lockdown" subscription and accessing the content2020-08-31673755.23755.2Cisco WebEx meetClick Here
U.Venkateswarlu ZoologyM.Sc FinalVideo on Plasma membrane,Osmoregulatory mechanisms in fishes.2020-08-312512481248Google MeetClick Here
B.Vijaya Rekha Zoology M.Sc II yearWater pollution and diseases 2020-08-312510401040Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearWater pollution and diseases 2020-08-3125936936Google meet Click Here
M.IndirammaEnglishIIBSc _A6,A7,A8Once upon a time_poem2020-08-3035195419100ZoomClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)praacheenaandhra padya saasanalu - Telugu basha sahityalu2020-08-301312901290online class through zoomClick Here
J kavithaMathematicsV semIdeals2020-08-3014060436043Google meetClick Here
B.Vijaya Rekha Zoology M.Sc II yearMicrobiological examination of water 2020-08-302511441144Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearWater pollution and diseases 2020-08-3025832832Google meet Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Proof of Gauss law2020-08-297559795979Google classroom and whatsappClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology- plasmamembrane structure & Functions2020-08-29381436.61436.6Lecturer method using PPt through Zoom AppClick Here
M.Kamala KarunachemistryIII B.Scamino acids2020-08-29551425.451425.45zoom meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsJkc TCSiON registration process2020-08-29772836.362735.06Webex app screen sharing Click Here
Kuchipudi SujathaChemistryIII BSC C2Trans Effect2020-08-2924520520.3Zoom AppClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearIR sestra vibrational frequency ,factors effecting vibrational frequency2020-08-2913750750Zoom meetingClick Here
Kuchipudi SujathaChemistryII Bsc C2group discussion on metal carbonyls2020-08-292810351035Zoom AppClick Here
Naga Prasanna. MZoology II MZC & BiZC nucleus2020-08-29341955.81852.9google meetClick Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam2020-08-2935351003497Cisco WebexClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides2020-08-2913646646Zoomapp through Screen sharing Lecture methodClick Here
U.Venkateswarlu ZoologyM.Sc Final Osmoregulation in fishes, Iso ,Hypo and Hypertonic solutions.2020-08-292512481248Google MeetClick Here
B.Vijaya Rekha Zoology M.Sc II yearBiological investigation of water 2020-08-292511441144Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearDissolved oxygen 2020-08-292513521352Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearBiological oxygen demand2020-08-292511441144Google meet Click Here
M.IndirammaEnglishIIBSc _A6,A7,A8Once upon a time_poem2020-08-2835226322100ZoomClick Here
Anusha KchemistryB.Sc. IIIsemcarbonyl compounds haloform reaction2020-08-2810238373837googlemeetClick Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam2020-08-2842421004198Cisco WebexClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Telugu Bhasha2020-08-28381642.11642.1Lecture method through Zoom appClick Here
Naga Prasanna. MZoology II MZC & BiZC Mitochondria2020-08-28342161.761852.94Google meetClick Here
Kuchipudi SujathaChemistryII Bsc C2EAN Rule and Ni(CO)4 Structure2020-08-282810351035ZOOM APPClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yeariR spectroscopy2020-08-2813750750zoom meetingClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-285031623162Coscx WebEx meeting appClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-285027542754Coscx WebEx meeting appClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionPlasmamembrane Structure-Models2020-08-28281242.861242.86Lecturer method using ppt through Zoom appClick Here
Dr.G.Swarna LathaTelugu3rd BASHTTelugu Bhashaa2020-08-2814637.5637.5Zoom ClassClick Here
B.SucharithaChemistryM.SC II YearNaturally occuring Insecticides2020-08-2813539539Lecture Method Using ZOOM App Click Here
Dr. K. SujathaTelugu III B. ABalavyakaranam-sangnaparichhedam2020-08-2814750750Zoom online class Click Here
Dr. K. SujathaTelugu II B. ScVaamanavatharam2020-08-285828482848Zoom online class Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Gauss law proof2020-08-287535473547Cisco WebExClick Here
J.KavithaMathematicsV semProblems on field and subring2020-08-2814570487048Google meetClick Here
M.Kamala KarunachemistryIII B.Scmetalloporphyrins and biological imp of metals2020-08-285514261222zoom meet Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)praangnannaya yugamu nandali praacheena saasanalloni Andhra basha saaraswathamulu2020-08-281312901290online class through zoomClick Here
Dr. Venkateswara Rao BodepudiHindiHindi III Semesterकाव्यदीप - तुलसी के दोहे2020-08-2869202920100Cisco Webex Here
U.Venkateswarlu ZoologyM.Sc FinalTest Conducted and Brief Introduction to Osmoregulation.2020-08-282513521352Google MeetClick Here
B.Vijaya Rekha Zoology M.Sc II yearChemical characterization of water 2020-08-282510401040Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearMinor elements of water 2020-08-282510401040Google meet Click Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam2020-08-2745451004191WebexClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-275026522652Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-275038763876Coscx WebEx meeting appClick Here
M.Kamala KarunachemistryIII B.Scmetalloporphyrins2020-08-27552443.62443.6zoom meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsMaxwell's thermodynamic equations 2020-08-27773646.753545.45Webex app Click Here
Anuaha KarumurichemistryB.Sc. IIIsemcarbonyl compounds cannizaro reaction2020-08-2710234333433googlemeetClick Here
Kuchipudi SujathaChemistryII Bsc C2Metal Carbonyls2020-08-2728621.4621.4Zoom AppClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vaamanaavathaaramu2020-08-27381334.211334.21Lecture method through Zoom appClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearstructural elucidation and synthesis of berberine2020-08-2713750750zom meeting Click Here
Dr. K. SujathaTelugu II B. ScVaamanavatharam2020-08-275828482848Zoom online class Click Here
Dr. K. SujathaTelugu II B. ScVaamanavatharam2020-08-275828482848Zoom online class Click Here
Dr. K. SujathaTelugu III B. ABalavyakaranam-sangnaparichhedam2020-08-2714750750Zoom online class Click Here
Dr.G.Swarna LathaTelugu3rd BASHTTelugu Bhashaa charitra introduction class2020-08-2714637.5637.5Zoom ClassClick Here
B.SucharithaChemistryM.SC II YearPhenothiazines Chemical reactions& Pharmacology2020-08-2713539539zoom app screen sharing Lecture methodClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws2020-08-272813471347Google meet lecture method with ppt Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel laws2020-08-273824632463Google meet lecture method with ppt Click Here
Latha BChemistryII BSc A1, B3, B4, B6Doubts Clarification2020-08-27603558.33558.3Cisco WebExClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Practical.. DeMorgan laws2020-08-277545604458Cisco WebExClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)praangnannaya yugamu nandali praacheena saasanalloni Andhra basha saaraswathamulu2020-08-271312901290online video class through zoomClick Here
Dr. Venkateswara Rao BodepudiHindiHindi III Semesterकाव्यदीप - कबीर के दोहे2020-08-2769162323100Cisco Webex Here
U.Venkateswarlu ZoologyM.Sc FinalMajor lakes and Major rivers in India.2020-08-272518721872Google MeetClick Here
B.Vijaya Rekha Zoology M.Sc II yearPhysical characterization of water 2020-08-272512481248Google meet Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Praangnannaya yugamunandali Andhra Basha sahitya viseshalu2020-08-261310901090Online class through zoomClick Here
Latha BChemistryII BSc A1, B3, B4, B6Quiz2020-08-26604168.34168.3Cisco Webex and Google formsClick Here
S J M PRATHAP KUMARZoologyIII MZC BiZCLayers management2020-08-263015501550Lecture method PowerPoint presentation shared in Google meetClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- structure of plasma membrane2020-08-26152462.51562.5Lecturer method using Plasmamembrane ppt through Zoom appClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Shyness,Myshield2020-08-2635144914100ZoomClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Electric and magnetic flux2020-08-267540564056Cisco WebExClick Here
U.Venkateswarlu ZoologyM.Sc FinalAccessory respiratory organs,Major lakes and rivers in India.2020-08-262514561456Google MeetClick Here
B.Vijaya Rekha Zoology M.Sc II yearBeneficial role of microorganisms in fermentation 2020-08-262513521352Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearManufacture of alcoholic beverages 2020-08-262515601560Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Chromosomes 2020-08-262813461346Google meet lecture method with ppt Click Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-265024482448Material send to whatsapp group and WebEx meeting appClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-265037743774WebEx meeting appClick Here
Dr. K. SujathaTelugu III B. ABalavyakaranam-sangnaparichhedam2020-08-2614750750Zoom online class Click Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsInformation about spoken tutorials2020-08-26773748.053748.05Webex appClick Here
Anuaha KarumurichemistryB.Sc. IIIsemcarbonyl compounds2020-08-2610238373736googlemeetClick Here
Naga Prasanna. MZoology III MZC & BiZC Gene transfer methods2020-08-26361233.331130.55Google meetClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearStructure and synthesis of Narcotine2020-08-2613750750Zoom meetingClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vaamanaavathaaramu2020-08-26381847.361847.36Lecture method through Zoom appClick Here
Rohini PEnglish2nd bsc b1to b6Once Upon A Time poem2020-08-268140484048Google MeetClick Here
B.SucharithaChemistryM.SC II YearPhenothiazines synthesis2020-08-2613754754zoom app lecture method through screen sharing assignment--1Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Andhravaangmaya charithra - yuga vibajana2020-08-251310901090Online class through zoomClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology- plasmamembrane structure2020-08-25382052.632052.63Lecturer method using ppt through Zoom AppClick Here
Kuchipudi SujathaChemistryII Bsc C2Metal Carbonyls2020-08-252814501450Whats appClick Here
U.Venkateswarlu ZoologyM.Sc FinalStructure and Function of the gills in fishes2020-08-252515601560Google MeetClick Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Polymerase chain reaction2020-08-25291862.061862.06zoom screen sharing-video playClick Here
M PADMAJAPolitical ScienceIII BANotes given2020-08-25451328.891328.89Notes givenClick Here
M PADMAJAPolitical ScienceII BAMinto Marle reforms2020-08-253418521852Lecture through webex appClick Here
S J M PRATHAP KUMARZoologyIII MZC BiZCGrowers management2020-08-25301963.331963.33Lecture method PowerPoint presentation shared Google meetClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology, viruses 2020-08-252813551355Material shared through WhatsApp and doubts clarifiedClick Here
B.Vijaya Rekha Zoology M.Sc II yearDifferent types of pollutions2020-08-252517681768Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics2020-08-253824652465Google meet lecture method with ppt Click Here
Y.Lakshmi Prasannachemistry M.Sc. II yearstructural elucidation and synthesis of dicentrine2020-08-2513885885zoom meetingClick Here
B.Vijaya Rekha Zoology M.Sc II yearWater pollution and analysis 2020-08-252513521352Google meet Click Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vaamanaavathaaramu2020-08-25322371.872371.87Lecture method through Zoom appClick Here
Rohini PEnglish2nd bsc b1to b6Once Upon A Time poem2020-08-258172887288Video linkClick Here
Dr. K. SujathaTelugu III B. ABalavyakaranam-sangnaparichhedam2020-08-2514428.6428.6Zoom online classClick Here
B.SucharithaChemistryM.SC II YearPhenothiazines synthesis2020-08-2513539539zoomapp screen sharingClick Here
Latha BChemistryII BSc A1, B3, B4, B6Metal Carbonyls2020-08-25603863.33863.3Cisco WebexClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-255017341734Material send to whatsapp group and WebEx meeting appClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-255040804080Material send to whatsapp group and WebEx meeting appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Vaangmyamu-saaraswathamu-Saahithyamu vivarana2020-08-241310901090Online class through zoomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-08-241817941717Online course, material circulated over WhatsApp Here
U.Venkateswarlu ZoologyM.Sc FinalLentic, Lotic habitats, Videos on gill respiration2020-08-242515601560Google MeetClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-241817941794Online course, material circulated over WhatsApp Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws2020-08-242811391139Google meet lecture method with ppt Click Here
J.KavithaMathematicsV semTheorem and problems on fields2020-08-2414476537653Google meetClick Here
Dr.G. Padmini DeviHomescience III B.Sc. H.Sc.elements of communication2020-08-24231982.161982.16zoomClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearstructural elucidation and synthesis of cinchonine2020-08-2413885885through zoom meeting by lecture methodClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- Fine structure of Cell wall2020-08-242814501450Lecturer method with the help of PPt through Zoom AppClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsGibbs free energy Enthalpy2020-08-247737483444.1Webex app Shared material in Google Classroom Click Here
Anuaha KarumurichemistryB.Sc. IIIsemcarbonyl compounds2020-08-2410237363736googlemeetClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vaamanaavathaaramu2020-08-24321856.251856.25lecture method through zoom appClick Here
B.SucharithaChemistryM.SC II YearPhenothiazines Classification,Methods of preparation2020-08-2413646646Lecture method,Zoom app screen sharingClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-245020402040WebEx meeting app online class and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-245037743774WebEx meeting app Click Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6Metal Carbonyls2020-08-246042704270Cisco WebexClick Here
A. SravaniCost accountingIII B. ComIntroduce2020-08-245020402040WhatsApp video callClick Here
M PADMAJAPolitical ScienceIII BAFeatures of ancient Indian Political Thought2020-08-244518401840LectureClick Here
M PADMAJAPolitical ScienceII BAIntroduction to Minto Marle reforms2020-08-24341852.941852.94Lecture through webex appClick Here
S J M PRATHAP KUMARZoologyIII MZC BiZCIntensive system in poultry2020-08-243015501550Lecture method PowerPoint presentation shared Google meetClick Here
B.Vijaya Rekha Zoology M.Sc II yearIntroduction of bacterial, viral diseases 2020-08-242510401040Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearIntroduction of fungal and protozoa diseases 2020-08-242515601560Google meet Click Here
Rohini PEnglish2nd bsc b1to b6Once Upon A Time poem2020-08-248172887288WhatsAppClick Here
Naga Prasanna. MZoology III MZC & BiZC Cosmids, BAC, YAC2020-08-243614361233.33Google meetClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-08-231817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-231817941794Online course, material circulated over WhatsApp Here
J.KavithaMathematicsV semTheorems on fields2020-08-2314452365236Google meetClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-08-221817941717Online course, material circulated over WhatsApp Here
U.Venkateswarlu ZoologyM.Sc FinalLimnology as an applied Science,Inland water types2020-08-2225830830Google MeetClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-221817941794Online course, material circulated over WhatsApp Here
Naga Prasanna. MZoology II MZC & BiZC Lysosomes2020-08-22341647.051441.17google meetClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Telugu Sahitya charithra2020-08-221310901090Online class through zoomClick Here
Dr. Venkateswara Rao BodepudiHindiHindi III SemesterHindi Syllabus & Model Paper2020-08-2169162316100 Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics2020-08-213827772777Video lesson shared n doubts clarified through WhatsApp group Click Here
U.Venkateswarlu ZoologyM.Sc FinalClassification of fishes,Limnology introduction2020-08-212515601560Google MeetClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearsynthsis of quinine2020-08-2113750750zoom meetingClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Note Making _practice2020-08-2175131713100Zoom AppClick Here
Latha BChemistryII BSc A1, B3, B4, B6Theories of Bonding in Metals2020-08-21614472.14472.1Cisco WebExClick Here
Kuchipudi SujathaChemistryV SEMReactivity of metal complexes2020-08-2124520520ZOOM APPClick Here
B DorkaBiochemistryIII BSc BiochemMeselson-Stahl Experiment2020-08-211812671267Zoom whiteboard - Lecture DiscussionClick Here
Naga Prasanna. MZoology II MZC & BiZC golgi complex2020-08-21341544.111441.17Google meetClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology-The Cell Wall2020-08-21241666.671666.67Lecturer method with ppt on Cell wall through Zoom appClick Here
M.Kamala KarunachemistryIII B.Sc test on photochemistry 2020-08-215527492749whats app and google class roomClick Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Gene transfer techniques -Natural methods 2020-08-21291965.511965.51Lecture method Zoom screen sharingClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel laws2020-08-213824652465Google meet lecture method with ppt.Click Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam2020-08-2148481004798Zoom appClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws2020-08-212813471347Google meet lecture method with ppt Click Here
B.SucharithaChemistryM.SC II YearTechniques to determine mechanism of a Chemical Reaction 2020-08-2113646646Lecture method by ZOOM AppClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Revision2020-08-217535463546Cisco WebExClick Here
M PADMAJAPolitical ScienceIII BASalient features of ancient Indian Political Thought2020-08-21451737.771737.77Lesson through webex appClick Here
B.Vijaya Rekha Zoology M.Sc II yearAdvanced techniques in immunology 2020-08-212513521352Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearDifferent types of immunological tests 2020-08-212514561456Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearVersatile techniques in immunology 2020-08-212515601560Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearPolymerases properties and functions 2020-08-202511441144Google meet Click Here
D. Vijaya SreeBiochemistryIII B4,B6antibodies structure2020-08-201611696969Zoom cloud meetingClick Here
Dr. Venkateswara Rao BodepudiHindiHindi III SemesterHindi Syllabus & Model Paper2020-08-2069111611100Zoom Click Here
Y.Lakshmi Prasannachemistry M.Sc. II yearStructural elucidation of Quinine2020-08-2013970970Through zoom meetngClick Here
Anuaha KarumurichemistryB.Sc. IIIsemHalogen compounds2020-08-2010232313231googlemeetClick Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Gene transfer techniques2020-08-20291965.511965.51zoom screen sharingClick Here
J kavithaMathematicsV semCancillation laws,integraldomain &field2020-08-2014460426042Google meetClick Here
Kuchipudi SujathaChemistryV SEMREACTIVITY OF METALS2020-08-2024520520ZOOM APPClick Here
Latha BChemistryII BSc A1, B3, B4, B6Metal Carbonyls2020-08-20604473.34473.3Cisco WebEx meetClick Here
U.Venkateswarlu ZoologyM.Sc FinalIntroduction to Limnology and Ichthyology2020-08-202514561456Google meetClick Here
Dr. g.padmini deviHomescience III B.Sc. H.scmodels of communication2020-08-202317731773zoomClick Here
M.IndirammaEnglishIIBSc _A6,A7,A8Note Making2020-08-2013129812100ZoomClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-205022442244Coscx WebEx meeting appClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-205031623162Coscx WebEx meeting appClick Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam2020-08-2040401003998Zoom appClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology- Fine structure of Cell wall2020-08-20381231.581231.58Lectureell method using ppt on Cell wall through Zoom appClick Here
B.SucharithaChemistryM.SC II YearTechniques to determine mechanism of a Chemical Reaction 2020-08-2013646646zoom app screen sharingClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Quiz on logic gates2020-08-205726432643Google classroom quizClick Here
S J M PRATHAP KUMARZoologyIII YEAR B2,B4Poultry house systems2020-08-203012401240Lecture method PowerPoint presentation shared Google meetClick Here
M.Kamala KarunachemistryIII B.Scbio inorganic chemistry2020-08-20553054.53054.5 zoom meetClick Here
B.Vijaya Rekha Zoology M.Sc II yearPolymerases properties and functions 2020-08-202511441144Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearReverse transcriptase properties and functions 2020-08-202512481248Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearPBR 322 and its derivatives 2020-08-202511441144Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearDNA ligases properties and functions 2020-08-1925936936Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearNucleases properties and functions 2020-08-1925936936Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearTypes of restriction endonucleases2020-08-1925832832Google meet Click Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)cloning vectors-plasmids2020-08-19291965.511965.51Lecture method -ZOOM- ppt screen sharingClick Here
J.KavithaMathematicsV semZero divisors of ring2020-08-1914576527652Google meet Click Here
M.Kamala KarunachemistryIII B.Scphoto physical processes2020-08-195527492749zoom meetClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearAlkaloids2020-08-1913540540Zoom meetingClick Here
Latha BChemistryII BSc A1, B3, B4, B6Metal Carbonyls2020-08-19604168.34168.3Cisco WebEx meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsEntropy2020-08-19773950.643950.64Webex appClick Here
Naga Prasanna. MZoology III MZC & BiZC bacteriophage vectors2020-08-193617501750Google meetClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vaamanaavathaaramu2020-08-193216501650Lecture method through Zoom appClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-195016321632Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingArithmetic mean2020-08-195034683468Coscx WebEx meeting app and material send to whatsapp groupClick Here
M PADMAJAPolitical ScienceII BASalient features of the Indian constitution2020-08-19483266.673266.67Study material given through whatsappClick Here
M PADMAJAPolitical ScienceIII BAAncient Indian Political Thought2020-08-19451635.551635.55Lesson through webexClick Here
RohiniEnglish2nd bsc b1to b6Shyness My Shield questions2020-08-198172887288What's appClick Here
S J M PRATHAP KUMARZoologyIII YEAR B2,B4Poultry house construction2020-08-19301033.331033.33Power point presentation shred Google meetClick Here
B.SucharithaChemistryM.SC II YearTechniques to determine mechanism of a Chemical Reaction 2020-08-1913431431Lecture method --- ZOOM appClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Logic gates practical2020-08-197534443444Cisco WebEx, recorded videoClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws2020-08-192810351035Lecture method pptClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology2020-08-193824652465WhatsApp group discussion material sharedClick Here
B DorkaBiochemistryIII BSc BiochemStudent details in APCCE - info 2020-08-191814781478Zoom Click Here
B.Vijaya Rekha Zoology M.Sc II yearTypes of restriction endonucleases2020-08-1925936936Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearDNA ligases properties and functions 2020-08-1925936936Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearNucleases properties and functions 2020-08-1925832832Google meet Click Here
M PADMAJAPolitical ScienceII BANational Movement2020-08-18482041.62041.6WebexClick Here
Anuaha KarumurichemistryB.Sc. IIIsemHalogen compounds2020-08-1810230293029lecture through google meetClick Here
Dr. g.padmini deviHomescience III B.Sc. H.scprocess of communication2020-08-18231878.21878.2zoomClick Here
J.KavithaMathematicsV semBoolean rings2020-08-1814485598559Google meetClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearOrd2020-08-1813750750zoom meetingClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectioncell Biology - Nucleus2020-08-18381436.841436.84Lecturer method using ppt on Cell Biology- The Nucleus through Zoom AppClick Here
B DorkaBiochemistryIII BSc BiochemMolecular Biology Models of Replication2020-08-181814781478Zoom Board; Lecture-DiscussionClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics2020-08-183824652465Google meet ppt Click Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Vaamanaavathaaramu2020-08-18321340.61340.6Lecture method through Zoom appClick Here
Naga Prasanna. MZoology III MZC & BiZC vectors - pbr and puc2020-08-18362055.551747.22google meetClick Here
M venkataramanaCommerceIII bcom generalCost sheet overheads2020-08-185017341734Coscx WebEx meeting app and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingBusiness statistics introduction2020-08-185034683468Coscx WebEx meeting appClick Here
M PADMAJAPolitical ScienceIII BASources of Indian Political Thought2020-08-183514401440Lecture through webex appClick Here
RohiniEnglish2nd bsc b1to b6Shyness My Shield2020-08-18818110081100What's appClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology material2020-08-182822782278WhatsApp group Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology material2020-08-182822782278WhatsApp group Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Half adder & full adder2020-08-187545604560Cisco WebExClick Here
Kuchipudi SujathaChemistryIII BSC C2group discussion in d block elements2020-08-1830723.3723.3group discussion by lecture methodClick Here
Latha BChemistryII BSc A1, B3, B4, B6Theories of Bonding in Metals2020-08-18603863.33863.3Cisco WebExClick Here
B.SucharithaChemistryM.SC II YearExamples of Multistep process Rearrangements & Mechanisms 2020-08-1813646646Lecture method by ZOOM appClick Here
S J M PRATHAP KUMARZoologyIII YEAR B2,B4Types of chickens2020-08-183018601860Lecture method PowerPoint presentation Google meetClick Here
S J M PRATHAP KUMARZoologyIII YEAR B2,B4Types of chickens2020-08-183018601860Lecture method PowerPoint presentation Google meet sharingClick Here
N Rajya LakshmiComputer ScienceIII BComIntroduction to C2020-08-183636100100100Whats app GroupClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearAlkaloids2020-08-1813540540Zoom meetingClick Here
B.Vijaya rekha Zoology II M.ScTools and techniques used in genetic engineering 2020-08-1725936936Google meetClick Here
B.Vijaya Rekha Zoology M.Sc II yearIntroduction about restriction endonucleases2020-08-172513521352Google meet Click Here
J kavithaMathematicsV semRing def ,examples and theorems2020-08-1714077557755Google meetClick Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearOptical rotatory dispersion2020-08-1713750750Zoom meetingClick Here
M PADMAJAPolitical ScienceIII BAAncient Indian Political Thought2020-08-17541425.921425.92Lecture method through Cisco WebExClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsCARNOT ENGINE problems2020-08-17773646.73646.7Webex appClick Here
DorkaBiochemistryIII BSc BiochemHershey & Chase Experiment2020-08-171815831583Zoom -Whiteboard, Lecture-DiscussionClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Chandassu2020-08-17321443.751443.75Lecture method through Zoom app using PPTClick Here
Naga Prasanna. MZoology III MZC & BiZC Restriction enzymes, types and applications2020-08-17361644.443644.44google meetClick Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6Theories of Bonding in Metals2020-08-17624166.14166.1Cisco Webex and Google classroomClick Here
M venkataramanaCommerceIII bcom generalPerforma of Cost sheet2020-08-175019381938WebEx meetingClick Here
M venkataramanaCommerceII bcom computer& bankingTypes of averages2020-08-175028562856WebEx meetingClick Here
G V BhaskarMathematics3 SemesterGroups2020-08-175046924692Cisco Webex Video appClick Here
B.SucharithaChemistryM.SC II YearExamples of Multistep process Rearrangements& Mechanisms 2020-08-1713754754Lecture Method by ZOOM AppClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectioncell Biology - Nucleus2020-08-172412501250Lecturer method through Zoom meeting using pptClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics2020-08-173818451845Google meet pptClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Genetics2020-08-1728825825Google meet ppt Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)De Morgan's laws2020-08-177545604560Cisco WebExClick Here
RohiniEnglish2nd bsc b1to b6Shyness My Shield2020-08-178172907290Google MeetClick Here
B.Vijaya Rekha Zoology M.Sc II yearTools and techniques used in genetic engineering 2020-08-1725936936Google meet Click Here
B.Vijaya Rekha Zoology M.Sc II yearIntroduction about restriction endonucleases2020-08-172513521352Google meet Click Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamics numerical problems2020-08-16772532.42532.4Webex appClick Here
G V BhaskarMathematics3 SemesterGroups2020-08-162518721872Cisco Webex Video appClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-08-161817941717Online course, material circulated over WhatsApp Here
Y.Lakshmi Prasannachemistry M.Sc. II yearmock test 1 in uv spectroscopy2020-08-151310851085 zoom meetingClick Here
Naga Prasanna. MZoology II MZC & BiZC specialised structures of plasma membrane and endoplasmic reticulum2020-08-15341235.291235.29google meetClick Here
B.SucharithaChemistryM.Sc;ll yearMethods to determine reaction mechanism of free radicals- chemical kinetics2020-08-1513431431Zoom appClick Here
D. Vijaya SreeBiochemistryIII B4, B6immune response2020-08-151813727272zoom meetingClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Carnot theorem2020-08-14772228.52228.5Webex appClick Here
Anuaha KarumurichemistryB.Sc. IIIsemHalogen compounds2020-08-1427102262726 lecture through google meetClick Here
Dr.G. Padmini DeviHomescience III B.Sc. H.Sc.communication 2020-08-142418751875zoom meetingClick Here
CH.A.A.S.K.G.BHAVANIHISTORYII B.A (III sem)introduction of kakatiyas2020-08-145426482648online class taken through zoom appClick Here
Kuchipudi SujathaChemistryII Bsc C2D Block Elements2020-08-1430413413lecture method by using zoom appClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- Cell Organells2020-08-14241666.671666.67Zoom App -Lecturer method- Material issued through whats app groupClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Chandassu2020-08-14321237.51237.5Lecture method through Zoom app using PPTClick Here
Naga Prasanna. MZoology II MZC & BiZC Functions of plasma membrane, Transport through plasma membrane, cell junctions2020-08-14341544.111544.11Google meetClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Logic circuits2020-08-147555735573Google classroomClick Here
B. SucharithaChemistryM.Sc II YearMethods to determine Reaction Mechanism of Free Radicals 2020-08-1413431431Lecture Method by ZOOM AppClick Here
Latha BChemistryII BSc A1, B3, B4, B6Theories of Bonding in Metals2020-08-14543870.43870.4Cisco Webex meetingClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearAbsorption maxima of aromatic compouds2020-08-1413540540Lecture- Discussion with board in Zoom classClick Here
Anuaha KarumurichemistryB.Sc. IIIsemHalogen compounds2020-08-1310232313231lectureClick Here
Y.Lakshmi Prasannachemistry M.Sc. II year Ultraviolet Spectroscopy 2020-08-1313750750 Ultraviolet Spectroscopy – Sample Problems in aromatic compounds Using Woodward-Fieser Rules Click Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6Theories of Bonding in Metals2020-08-13523465.43465.4Cisco webexClick Here
Naga Prasanna. MZoology II MZC & BiZC Plasma membrane - various models of plasma membrane2020-08-13341955.881852.94GOOGLE MEETClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Chandassu2020-08-13321031.251031.25Lecture method through Zoom app using PPTClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Second law of thermodynamics2020-08-13772633.72633.7Webex appClick Here
Kuchipudi SujathaChemistryII Bsc C2D Block Elements2020-08-1331620620Lecture Method By using zoon app Click Here
Kuchipudi SujathaChemistryIII BSC C2Bio In Organic elements2020-08-132414581458material shared with whatsappClick Here
B.SucharithaChemistryM.Sc. chemistry IIYearFree radical reactions and mechanism2020-08-1313540540Through zoom meetingClick Here
DorkaBiochemistryIII BSc BiochemAvery, MacLeod, McCarty Experiment2020-08-131810561056Lecture- Discussion with board in Zoom classClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cellbiology all topics revised2020-08-133821552155Google meet ppt Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology all topics revised2020-08-1328822822Google meet with pptClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Universal gates2020-08-137537503750Cisco WebExClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6immunoglobulin structure2020-08-1318845845Cisco Webex Meetings Click Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology-The Cell Wall2020-08-13381231.81231.8Lecturer method through Zoom meeting using PPtClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology2020-08-132815531553WhatsApp group Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-08-131817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-131817941794Online course, material circulated over WhatsApp Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Logic gates assignment2020-08-127554725472Google classroomClick Here
B. Sucharithachemistry M.Sc. II yearfree radical reactions and mechanisms2020-08-1213540540zoom app using board and material issued by whats appClick Here
DorkaBiochemistryIII BSc BiochemGriffith Transformation2020-08-121813721372Lecture - Discussion with drawingsClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6immunoglobulin introduction2020-08-121814781478Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-08-121817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-121817941794Online course, material circulated over WhatsApp Here
M venkataramanaCommerceIII bcom generalTypes of costing2020-08-125018361836WebEx meetingClick Here
Naga Prasanna. MZoology III MZC & BiZC Genetic engineering and its applications2020-08-12361747.21747.2Google meetClick Here
M venkataramanaCommerceII bcom computer& bankingBar diagrams2020-08-125027542754WebEx meetingClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Chandassu2020-08-12321546.81340.6Lecture method through Zoom app using PPTClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsCarnot cycle 2020-08-12773038.963038.96Webex appClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part 62020-08-1213540740through zoom meeting by ppt and issued material by whatsappClick Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6d-block elements2020-08-12523567.33567.3Cisco Webex and Google class roomClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mitochondria 2020-08-123818471847Google meet ppt Click Here
B.Sucharithachemistry M.Sc. II yearfree radical reactions and mechanisms2020-08-1113750750 through zoom meeting by ppt and using board issued material by whatsappClick Here
DorkaBiochemistryIII BSc BiochemMolecular Biology2020-08-111814781478Lecture- Discussion Google meetClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-08-111817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-111817941794Online course, material circulated over WhatsApp Here
Y.Lakshmi PrasannaChemistryM.Sc. chemistry IIYearUv spectra part 52020-08-1113750750Through Zoom meeting using ppt and material issued by whatsappClick Here
Anuaha KarumurichemistryB.Sc. IIIsemHalogen compounds2020-08-1110219181918lectureClick Here
Naga Prasanna. MZoology III MZC & BiZC biotechnology introduction2020-08-11361644.441438.88google meetClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsOnline test/quiz(bridge course test)2020-08-11732128.762128.76TestmozClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Logic gates2020-08-117535463546Cisco WebExClick Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6d-block elements2020-08-11452555.562555.56Cisco webex and Google classroomClick Here
B.Sucharithachemistry M.Sc. II yearfreeradical mechanisms2020-08-1013540540through zoom meeting by ppt and using board issued material by whatsappClick Here
DorkaBiochemistryIII BSc BiochemMolecular Biology2020-08-101815831583Material Sharing through WhatsappClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6lymph node2020-08-1018845845Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-08-101817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-101817941794Online course, material circulated over WhatsApp Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part 42020-08-1013750750lecture method by zoom meeting share the material by using whats appClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Chandassu2020-08-10321031.251031.25Lecture method through zoom app using PPTClick Here
M venkataramanaCommerceIII bcom generalTypes of costing2020-08-105012241224WebEx meeting and material send to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer& bankingBar diagrams2020-08-105026522652WebEx meetingClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Nucleus2020-08-103821442144Google meet pptClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Nucleus2020-08-103013431343Google meet pptClick Here
Kuchipudi SujathaChemistryII Bsc C2D Block Elements2020-08-103510281028.5Lecture method using Zoom appClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsCARNOT ENGINE2020-08-10732432.82432.8Webex appClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system quiz2020-08-105439723972Google classroom, quizizzClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-08-091817941717Online course, material circulated over WhatsApp Here
D. Vijaya SreeBiochemistryIII B4, B6organs of immune system-notes2020-08-091616100100100whatsappClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-091817941794Online course, material circulated over WhatsApp Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part 42020-08-0913750750lecture method through zoom meeting using ppt and material issued by whatsappClick Here
B.SucharithaChemistryM.SC II YearOxidaton of Aldehydes,Ketones2020-08-0913646539Zoom App meetingClick Here
Dr. N. VijayalakshmiTeluguII B.Com (computers & Banking)Chandassu2020-08-0832928928Lecture method in Zoom meeting with using PPTClick Here
Naga Prasanna. MZoology II MZC & BiZC animal cell structure and function2020-08-083417501441Google meetClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology, Ribosomes Golgicomplex2020-08-083815401540Google meet pptClick Here
Latha BChemistryII BSc A1, B3, B4, B6d-block elements2020-08-08452862.22862.2Cisco Webex meeting and WhatsappClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part 32020-08-0813750750zoom meeting sharing ppt and material issued by whatsappClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part 32020-08-0813750750zoom meeting sharing ppt and material issued by whatsappClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology, Ribosomes Golgicomplex2020-08-082813441344Google meet pptClick Here
Dr.Ch. Bhaskara RaoBotanyIII year BZC -C1 sectionCell Biology- Cell Organells2020-08-08382052.632052.63Lecturer method through ZOOM AppClick Here
Anuaha KarumurichemistryB.Sc. IIIsemd-Block2020-08-0810220192019lectureClick Here
KuchipudisujathachemistryII Bsc C2d block elements2020-08-08351131.41131by using zoom app through lecture methodClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsREVERSIBLE AND IRREVERSIBLE PROCESSES 2020-08-08732635.62635.6Webex appClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system2020-08-085221402140Google classroom quizizzClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system2020-08-085221402140Google classroom quizizzClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system2020-08-085221402140Google classroom quizizzClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6spleen2020-08-071810561056Cisco Webex Meetings Click Here
M.Kamala KarunachemistryIII B.Scsteps in photo chemical reactions2020-08-07553258.13258.1explained content via zoom metingClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-08-071817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-071817941794Online course, material circulated over WhatsApp Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Endoplasmicreticulum2020-08-073817451745Google meetClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking) Retail Banking2020-08-0712758.33758.33Using google meet app with video callClick Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6d-block elements2020-08-07452453.32453.3Cisco webex meetingClick Here
M venkataramanaCommerceIII bcom generalCost accounting2020-08-075020402040WebEx meeting and material issued to whatsapp groupClick Here
M venkataramanaCommerceII bcom computer & bankingBusiness statistics introduction2020-08-075027542754WebEx meeting and material issued to whatsapp groupClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part 22020-08-0713970970through zoom app using ppt and material is issued by whatsappClick Here
Naga Prasanna. MZoology II MZC & BiZC Virus, viroids and mycoplasmas2020-08-0734823.52823.52Google meetClick Here
Dr.Ch. Bhaskara RaoBotany3 rd year BSC-B1 sectionCell Biology- The cell2020-08-07241458.331458.33Lecturer method through Zoom appClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Derivation for workdone in adiabatic process2020-08-07732635.62635.6Webex appClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6bone marrow2020-08-061811611161Cisco Webex Meetings Click Here
M.Kamala KarunachemistryIII B.Scphoto chemistry2020-08-06325558.13258.1zoom appClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-08-061817941717Online course, material circulated over WhatsApp Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Restriction endonucleases2020-08-06291965.511965.51Lecture method -screen sharing through ZoomClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-061817941794Online course, material circulated over WhatsApp Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-0630927927WebEx meeting and material issued whatsapp groupClick Here
M venkataramanaCommerceIII bcom generalRural and farm credit2020-08-063010301030WebEx meetingClick Here
Naga Prasanna. MZoology II MZC & BiZC Introduction to cell, History, cell theory and prokaryotic cell structure and components2020-08-06341029.41029.4google meetClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology, plasmamembrane2020-08-063811291129Google meet Click Here
M venkataramanaCommerceII bcom computer& bankingBusiness statistics introduction2020-08-065023462346WebEx meetingClick Here
N.DivyasriCommerceIII Commercial geography2020-08-062515606060Online class through WebEx meeting app and material shared to students through WhatsApp groupClick Here
N.DivyasriCommerceIII Office management2020-08-062515601560Online class through WebEx meeting appClick Here
N.DivyasriCommerceII Banking theory and practice2020-08-0610660669Online class through WebEx meeting app and material send to students through WhatsApp groupClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology, plasmamembrane2020-08-063012401240Google meet Click Here
Latha BChemistryII BSc A1, B3, B4, B6Colour and catalytic properties of d-block elements2020-08-06452351.12351.1Cisco Webex and Google classroomClick Here
Dr.Ch. Bhaskara RaoBotany3 BZC- C1Cell Biology2020-08-06352057.142057.14Lecturer method through Zoom AppClick Here
Y.Lakshmi Prasannachemistry M.Sc. II yearUV SPECTROSCOPY Part I2020-08-061311851185zoom meeting through ppt and material issued by whatsappClick Here
B.SucharithaChemistryM.SC II YearOxidation of Alcohols2020-08-0613646539Zoom App meeting Lecture methodClick Here
Anuaha KarumurichemistryB.Sc. IIIsemd-Block2020-08-0610215141514lec tureClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Derivation for workdone in isothermal process2020-08-06732128.72128.7Webex appClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system2020-08-067539523952Cisco WebExClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6thymus2020-08-051812671267Cisco Webex Meetings Click Here
M.Kamala KarunachemistryIII B.Scintroduction of syllabus VI paper2020-08-053822582258zoom meetingClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-08-051817941717Online course, material circulated over WhatsApp Here
Dr.N.AnkammaZoology111 B.Sc,B.Z.C(E.M)Introduction to Animal Biotechnology2020-08-05291965.511965.51Lecture method-Screen sharing through ZoomClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology, Eukaryotic cell2020-08-053812361236Google meetClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-08-051817941794Online course, material circulated over WhatsApp Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology, Eukaryotic cell2020-08-053012401240Google meet Click Here
Y.Lakshmi Prasannachemistry M.Sc. UV SPECTROSCOPY Part I2020-08-051310771077zoom application and materials shared by whats appClick Here
M venkataramanaCommerceIII bcom generalCost sheet2020-08-0530722722Whatsapp group video callClick Here
M venkataramanaCommerceII bcom computerBusiness statistics introduction2020-08-0530824824Whatsapp group video callClick Here
Latha BChemistryII BSc A1, B3, B4, B6electronic configuration and variable oxidation sates of d-block elements2020-08-05452453.32453.3Cisco Webex meeting and Google classroomClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system2020-08-057550675067Google classroomClick Here
B.SucharithaChemistryM.SC II YearOxidations of saturated active groups2020-08-0513754539Zoom App meetingClick Here
Anuaha KarumurichemistryB.Sc. IIIsemd-Block2020-08-0510217161716LectureClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Isothermal and adiabatic processes2020-08-05731317.81317.8Webex appClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6Assesment2020-08-04181810018100Cisco Webex Meetings Click Here
Latha BChemistryII BSc A1, B3, B4, B6Charecteristic properties of d-block elemens2020-08-04442964.42964.4Ciusco Webex meeting and Google classroom Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Cell biology, viruses 2020-08-0438925925Google meetClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology, viruses 2020-08-0428414414Google meetClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Number system2020-08-047544584458Cisco WebExClick Here
B.SucharithaChemistryM.SC II YearOxidation of Aromatic rings2020-08-0413646539Zoom app lecture methodClick Here
Anuaha KarumurichemistryB.Sc. IIIsemd-Block2020-08-0410212111211lectureClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamics basics bridge course2020-08-04732838.32838.3Webex appClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6organs of immune system2020-08-031811611161Cisco Webex Meetings Click Here
Dr N MANJULA BHARATHIPhysicsIII B.Sc.(MPCs)Number system2020-08-033017561756Cisco WebEx & Google classroomClick Here
B.SucharithaChemistryM.SC II Yearhydro carbons&alkenesOxidations---Different oxidation process2020-08-0313431431Zoom app meetingClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamics basics bridge course2020-08-03732534.22534.2Webex appClick Here
Anusha KChemistryIII B.Sc.D block2020-08-0210211101110Lecture through zoom appClick Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6d-block elements2020-08-024225592559Webex MeetingClick Here
B.SucharithaChemistryM.SC II Yearsyllabus,Oxidations introduction---Examples2020-08-0213539439Zoom app lecture methodClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamics basics bridge course2020-08-02731317.81317.8Webex appClick Here
B.Vijaya Rekha Zoology M.Sc II yearBioenergetics, the origins of complexity2020-08-0125936936Google meetClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6Review of immunology2020-08-011811611161Cisco Webex Meetings Click Here
Dr Latha B ChemistryII BSc A1, B3, B4, B6Introduction to syllabus and Exam Pattern2020-08-01422252.42252.4Virtual Class through WebexClick Here
Dr N MANJULA BHARATHIPhysicsIII B.Sc.(MPC)Number system2020-08-014527522752Cisco WebExClick Here
y.Lakshmi PrasannachemistryM.Sc. Chemistryorganic spectroscopy I2020-08-0113754754zoom app materials shared by whats appClick Here
B.SucharithaChemistryM.SC II Year)xidations2020-08-0113539539Zoom app screen shareClick Here
Anuaha KarumurichemistryB.Sc. IIIsemd-Block2020-08-01102109.8109.8lectureClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamics basics bridge course2020-08-01732838.352838.35Webex appClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6maacrophages2020-07-3118633633Cisco Webex Meetings Click Here
Dr N MANJULA BHARATHIPhysicsIII B. Sc(MPC)Number system2020-07-314526522652Cisco WebEx, Google classroomClick Here
SHAIK JUBEDAPHYSICSII BSc(MPC&mpcs)Thermodynamics syllabus introduction2020-07-30732331.52331.5Webex appClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6B cells2020-07-2918740740Cisco Webex Meetings Click Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6T cells2020-07-2818845845Cisco Webex Meetings Click Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6cells of immune system - hemotopoietic stem cells2020-07-2518739739Cisco Webex Meetings Click Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6EXAM2020-07-2418845845Cisco Webex Meetings Click Here
P HarshithaStatisticsI B.Sc. Problem on regression analysis2020-07-2410660660Zoom applicationClick Here
P HarshithaStatisticsI B.Sc. Correlation vs regression2020-07-2310660660Zoom applicationClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6Adaptive Immunity2020-07-221810561056Cisco Webex Meetings Click Here
P HarshithaStatisticsI B.Sc. Properties of regression coefficients2020-07-2210660660Zoom applicationClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6inflammation2020-07-211810561056Cisco Webex Meetings Click Here
P HarshithaStatisticsI B.Sc. Regression coefficient2020-07-2110660660Zoom applicationClick Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6inflammation2020-07-201810561056Cisco Webex Meetings Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Andhra vaangmaya Charithra - yuga vibajana2020-07-201310751075online class through zoomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-07-191817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-191817941794Online course, material circulated over WhatsApp Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)vaangmyamu-saaraswathamu-saahithyam2020-07-181310751075online class through zoomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-07-181817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-07-181817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Derivation of regression lines2020-07-1810880880Zoom applicationClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-181817941794Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6phagocytosis2020-07-1718845845Cisco Webex Meetings Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Telugu saahitya charithra2020-07-171310751075online class through zoomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-07-171817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-07-171817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Lines of regression2020-07-1710880880Zoom applicationClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-171817941794Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryIII BSC BIO CHEM B4,B6phagocytosis2020-07-1618845845Cisco Webex Meetings Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Telugu saahitya charithra2020-07-161310801080online class through zoomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-07-161817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-161817941717Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryB4,B6 chemical barriers2020-07-151812671267Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-151817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Introduction to regression analysis2020-07-1510990990Zoom applicationClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-151817941717Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryB4,B6innate immunity -skin 2020-07-141810561056Cisco Webex Meetings Click Here
P HarshithaStatisticsI B.Sc. Problems on tied rank method2020-07-1410660660Zoom applicationClick Here
D.Vijaya SreeBiochemistryB4,B6innate immunity - pH temperature2020-07-1318845845Cisco Webex Meetings Click Here
D.Vijaya SreeBiochemistryB4,B6types of immune system introduction 2020-07-1218845845Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-121817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-121817941717Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryB4,B6organisation of immune system2020-07-1118740740Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-111817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-111817941717Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryB4,B6introduction to immunology2020-07-1018844844Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-101817941717Online course, material circulated over WhatsApp Here
D.Vijaya SreeBiochemistryB4,B6intoduction to V sem2020-07-0918844844Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-091817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-091817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Problems on tied rank method2020-07-0910880880Zoom applicationClick Here
D.Vijaya SreeBiochemistryB4,B6syllabus2020-07-0818740740Cisco Webex Meetings Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-07-081817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Problems on spearmans rank correlation2020-07-0810770770Zoom applicationClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-081817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc. Problems on spearmans correlation coefficient2020-07-0710880880Zoom application Click Here
P Harshitha Statistics I B.Sc.Limits for spearmans correlation coefficient 2020-07-0610880880Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-07-051817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-051817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-07-041817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-041817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-07-031817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc.Derivation of spearmans correlation coefficient2020-07-0310770770Zoom application Click Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-031817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-07-021817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc.Rank correlation 2020-07-0210990990Zoom application Click Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-021817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-07-011817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc.Results on correlation 2020-07-0110550550Zoom application Click Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-07-011817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc.Results on correlation coefficient2020-06-3010990990Zoom application Click Here
P Harshitha Statistics I B.Sc. Results on correlation coefficient2020-06-2910990990Zoom application Click Here
D KrishnapriyaHomescienceII B.Sc Housing and interior decorationImportance of interior decoration2020-06-29241562.51250Google classroomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-281817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-281817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-271817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc. Results on correlation coefficient2020-06-2710990990Zoom application Click Here
D krishnapriyaHomescienceII B.Sc Housing and interior decorationForms of fatigue2020-06-27241562.51250Google classroomClick Here
D krishnapriyaHomescienceIII B.scResource management list out non human resources2020-06-272010501050Google classroomClick Here
D krishnapriyaHomescienceIII B.ScGeneral psychology Ravens progressive matrices2020-06-272010501050Googlr classroomClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-271817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-261817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc. Results on correlation 2020-06-26101010010100Zoom application Click Here
D krishnapriyaHomescienceII B.Sc Housing and interior decoration designing circulation spaces2020-06-26241562.51250Google classroomClick Here
D krishnapriyaHomescienceIIIB.Sc Resource management list out human resources2020-06-262010501050Google class roomClick Here
D krishnapriyaGeneral psychologyIII B.ScGeneral psychology muller lyer illusion2020-06-262010501050Google classroomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-251817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-251817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-241817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-241817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc. Problems on change of origin and scale method 2020-06-23101010010100Zoom application Click Here
D krishnapriyaHomeescienceII B.ScHousing and interior decoration types of furnishings2020-06-23241562.51041.6Google classroomClick Here
D krishnapriyaResource managementIII B.Sc HomescienceValues goals and standards interreation between them2020-06-23241562.5625Google classroomClick Here
D krishnapriyaHomescienceIII B.Sc General PsychologyStyles and types of learning2020-06-23201050945Google class roomClick Here
P Harshitha Statistics II B.Sc.Sign test for one sample 2020-06-2210990990Zoom application Click Here
D krishnapriyaHomescienceIII B.Sc General psychology Tests and types of intelligence2020-06-22201050945Google classroomClick Here
D krishnapriyaHomescienceIII B.Sc Resource managementTypes of decisions and decision making process2020-06-22201050945Google classroomClick Here
D krishnapriyaHomescienceII B.ScHousing needs in different stages of family life cycle2020-06-22241562.51041.6Google classroomClick Here
P Harshitha Statistics I B.Sc.Problems on correlation coefficients2020-06-21121210012100Zoom application Click Here
P Harshitha Statistics II B.Sc.Non parametric tests2020-06-2110880880Zoom application Click Here
P Harshitha Statistics III B.Sc.Problems on time reversal tests2020-06-2110770770Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-211817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-211817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-211817941717Online course, material circulated over WhatsApp Here
P Gousiya KhanamMathematics2 yearInfinite Series2020-06-2010440440Zoom Video appClick Here
P Harshitha Statistics I B.Sc.Properties of correlation coefficient2020-06-20101010010100Zoom application Click Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceElectrical fittings and fixtures2020-06-202415621041Google classroomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemYerrana2020-06-201817941717Online course, material circulated over WhatsApp Here
D krishnapriyaResource managementIII B.Sc HomescienceManagement process2020-06-20201050945Google classroomClick Here
D krishnapriyaHomescienceIII B.ScConcept of perception and attention2020-06-20201050945Google classroomClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-201817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceII Bcom (Banking) Broad Regulatory Framework And Instruments – Money Market2020-06-19181583.331583.33Ppts sent to students through the whatsApp groupsClick Here
M venkataramanaCommerceII bcom generalResidential status2020-06-19121210012100Google duo appClick Here
M venkataramanaCommerceII bcom Agreement2020-06-19302066.672066.67Whatsapp groupClick Here
P Gousiya KhanamMathematics2 yearInfinite Series2020-06-1910550550Zoom Video appClick Here
P Harshitha Statistics I B.Sc.Properties of correlation coefficient2020-06-191210911091Zoom application Click Here
P Harshitha Statistics II B.Sc.F test for equality of two variances2020-06-1910880880Zoom application Click Here
P Harshitha Statistics III B.Sc.Problems on index numbers 2020-06-1910660660Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-191817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-191817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-191817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) MARKETING Product Branding and it's types2020-06-183027902790Ppts sent to students through the whatsApp groupsClick Here
N. BHAGYA RAJUCommerceIII Bcom (General) Financial services Leasing2020-06-182520802080Ppts sent to students through the whatsapp GroupsClick Here
M venkataramanaCommerceII bcom generalProvident fund2020-06-1812866.67866.67Whatsapp video callClick Here
M venkataramanaCommerceII bcom Offer2020-06-1812650650Whatsapp video callClick Here
P Gousiya KhanamMathematicsIII Semester A3Abstract Algebra Groups2020-06-183018601860Zoom Video appClick Here
P Harshitha Statistics I B.Sc. Measures of correlation coefficient2020-06-181211911191Zoom application Click Here
P Harshitha Statistics II B.Sc.Chi square test for independence of attributes 2020-06-1810880880Zoom application Click Here
P Harshitha Statistics III B.Sc.Problems on weighted aggregate price index 2020-06-1810660660Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-181817941717Online course, material circulated over WhatsApp Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceBody mechanics principles2020-06-18241562.5625Google classroomClick Here
D krishnapriyaGeneral psychologyIII B.Sc HomescienceTheories of personality2020-06-18201050945Google classroomClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-181817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceIII Bcom (Banking) Fundamental Analysis industry life cycle2020-06-171512801280Ppts sent to students through the whatsapp GroupsClick Here
M venkataramanaCommerceII bcom generalPerquisites2020-06-1712650650Whatsapp video callClick Here
P Gousiya KhanamMathematicsIII Semester A3Abstract Algebra Groups2020-06-173020672067Zoom Video appClick Here
P Harshitha Statistics III B.Sc.Problems on ratio to trend method2020-06-1710660660Zoom application Click Here
P Harshitha Statistics II B.Sc.Chi square test applications2020-06-1710880880Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-171817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-171817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-171817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceII Bcom (Banking) FIM impact of monetary policy2020-06-16191789.471789.47Ppts sent to students through the whatsapp groupsClick Here
M venkataramanaCommerceII bcom generalIncometax2020-06-1612866.67866.67Whatsapp video callClick Here
M venkataramanaCommerceII bcom generalBusiness laws2020-06-1612650650Whatsapp video callClick Here
P Harshitha Statistics I B.Sc.Introduction to correlation 2020-06-16101010010100Zoom application Click Here
P Harshitha Statistics II B.Sc.Paired t test for difference in means and correlation coefficient2020-06-1610770770Zoom application Click Here
P Harshitha Statistics III B.Sc.Problems on seasonal variations2020-06-1610880880Zoom application Click Here
N.DivyasriCommerceI Macro environment2020-06-16302583.332583.33Ppt share to students through WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (General) Financial services Commercial papers2020-06-15282692.862589.29Ppts sent to the students through the whatsapp groupsClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) Marketing product line decisions2020-06-15393589.743589.74Ppts sent to the students through whatsapp groupsClick Here
P Harshitha Statistics I B.Sc.Theory of estimation introduction class2020-06-151211921192Zoom application Click Here
M venkataramanaIncometaxII bcom generalAllowance2020-06-1512650650Duo appClick Here
P Harshitha Statistics III B.Sc.Problems on principal of least square method2020-06-1510770770Zoom application Click Here
P Harshitha Statistics II B.Sc.T test for equality of two population means2020-06-1510880880Zoom application Click Here
P Gousiya KhanamMathematicsIII Semester A3Abstract Algebra Groups2020-06-154010251025Zoom Video appClick Here
M venkataramanaManagement accountingIII bcomCash flow statement2020-06-15302066.672066.67Whatsapp groupClick Here
D krishnapriyaHousing and interior decorationII B.Sc homescienceDefine orientation aspect prospect privacy2020-06-15241354937.5Google class roomClick Here
D krishnapriyaHomescienceIII B.Sc Resource management consevation of resources2020-06-15201050945google classroomClick Here
D krishnapriyaHomescienceIII B.ScObservational clinical and survey methods2020-06-15201050945Google classroomClick Here
P Gousiya KhanamMathematicsIII Semester A3Abstract Algebra Groups2020-06-144038953895Zoom Video appClick Here
P Harshitha Statistics III B.Sc.Problems on moving average method of time series 2020-06-1410770770Zoom application Click Here
P Harshitha Statistics II B.Sc. t test for single mean2020-06-1410550550Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-141817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemArthageetham Devarakonda Balagangadhar Tilak2020-06-141817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceII Bcom (Banking) Financial intermediaries and their role2020-06-13191789.471684.21Ppts sent to the students through the whatsApp groupsClick Here
M venkataramanacommerceIII bcommarginal costing2020-06-13302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIIBcom generalbusiness laws2020-06-133015501550WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) Marketing product mix2020-06-13423583.333378.57Ppts sent to students through the whatsapp GroupsClick Here
P Gousiya KhanamMathematicsIII Semester A3Abstract Algebra Groups2020-06-134030753075Zoom Video appClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-131817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-131817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceIII Bcom (General) Financial services Demat account required documents2020-06-12322887.52887.5Ppts sent to the students through the whatsapp GroupsClick Here
M venkataramanacommerceIII bcommarginal costing2020-06-12302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIIBcom generalincome tax2020-06-123015501550WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking) Fundamental Analysis Industry Analysis2020-06-12171694.121588.24Ppts sent to the students through the whatsapp groupsClick Here
K.VenugopalaraoCommerceIII Ratio analysis2020-06-12302583.332583.33Material send to students through WhatsApp groupClick Here
K.VenugopalaraoCommerceI Business economics2020-06-12302583.332583.33Material send to students through WhatsApp groupClick Here
P Harshitha Statistics III B.Sc.Abridge life table 2020-06-1210660660Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-121817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-121817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Problems on normal distribution2020-06-1210880880Zoom applicationClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) Product life cycle2020-06-114030753075Ppts sent to the students thorough the whatsapp groupsClick Here
N. BHAGYA RAJUCommerceIII Bcom (General) Financial services Demat services2020-06-11302583.332583.33Material sent to the students through the whatsapp GroupsClick Here
M venkataramanacommerceIII bcommarginal costing2020-06-11302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIIBcom generalincome tax2020-06-113015501550WhatsApp groupClick Here
P Harshitha Statistics II B.Sc.Test for two correlation coefficients 2020-06-1110550550Zoom application Click Here
P Harshitha Statistics III B.Sc.Construction of life tables2020-06-1110660660Zoom application Click Here
G V BhaskarMathematicsIII SemesterAbstract Algebra Groups2020-06-115045904590Zoom Video appClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemTikkana2020-06-111817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-111817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Problems on normal distribution2020-06-1110440440Zoom applicationClick Here
N. BHAGYA RAJUCommerceII Bcom (Banking) Money Market Instruments2020-06-10151386.671386.67Ppts sent to the students through the whatsapp groupsClick Here
M venkataramanacommerceIII bcomcash flow statement2020-06-10302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIII bcomExIM bank2020-06-103015501550WhatsApp groupClick Here
P Harshitha Statistics III B.Sc.Concept of life tables2020-06-1010770770Zoom application Click Here
P Harshitha Statistics II B.Sc.Test for single correlation coefficients2020-06-1010770770Zoom application Click Here
P Gousiya KhanamMathematicsIII SemesterAbstract Algebra Groups2020-06-104028702870Zoom Video appClick Here
N.DivyasriCommerceI computersTop ERP vendors2020-06-10302583.332583.33Material send to students through WhatsApp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-06-101817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-101817941717Online course, material circulated over WhatsApp Here
P HarshithaStatisticsI B.Sc. Properties of Cauchy distribution2020-06-1010550550Zoom applicationClick Here
P Harshitha Statistics I B.Sc.Cauchy distribution 2020-06-0910770770Zoom application Click Here
M venkataramanacommerceIII bcomfunds flow statement2020-06-09302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIIBcom computercommercial bank2020-06-093015501550WhatsApp groupClick Here
P Harshitha Statistics II B.Sc.Test for two proportions 2020-06-0910550550Zoom application Click Here
P Harshitha Statistics III B.Sc.Measures of population growth 2020-06-0910660660Zoom application Click Here
G V BhaskarMathematicsIII SemesterAbstract Algebra Groups2020-06-095042844284Zoom Video appClick Here
K.VenugopalaraoCommerceI Share capital short answer questions2020-06-09302583.332583.33Material send to students through WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking) Types of economic indicators2020-06-09171588.241588.24Ppts sent to the students through whatsapp groupsClick Here
P Harshitha Statistics II B.Sc.Test for single proportion 2020-06-0810880880Zoom application Click Here
N. BHAGYA RAJUCommerceIII Bcom (General) Securitization 2020-06-08322887.52887.5Ppts sent to the students through the whatsApp groups Click Here
M venkataramanacommerceIII bcommanagement accounting2020-06-08302066.672066.67WhatsApp groupClick Here
G v BhaskarMathematicsIII SemesterGroups2020-06-085043864386Zoom Video appClick Here
N.DivyasriCommerceIII Differences between products and services marketing2020-06-08302583.332066.67Material send to students through WhatsApp groupClick Here
P Harshitha Statistics III B.Sc.Measures of fertility2020-06-0810880880Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-06-071817941717Online course, material circulated over WhatsApp Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-071817941717Online course, material circulated over WhatsApp Here
G V BhaskarMathematicsIII SemesterAbstract Algebra Groups2020-06-075035703570Zoom Video appClick Here
P Harshitha Statistics III B.Sc.Measures of mortality2020-06-0710880880Zoom application Click Here
P Harshitha Statistics II B.Sc.Test for two standard deviations2020-06-0710880880Zoom application Click Here
M venkataramanacommerceIII bcommarginal costing2020-06-06302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIIBcom generalincome tax2020-06-063015501550WhatsApp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-06-061817941717Online course, material circulated over WhatsApp Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceArt elements and art principles2020-06-06241041.6312.5Assignment-google classroomClick Here
D krishnapriyaHomescienceIII B.ScHousing and interior decoration quiz2020-06-06201050945Google form google classroomClick Here
D krishnapriyaHomescienceIII B.ScNutrition2020-06-06201050945Google form google classroomClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-061817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceII Bcom (Banking) Finanancial instrumens and markets2020-06-06181583.331583.33Ppts sent to the students through whats app groups Click Here
P Harshitha Statistics I B.Sc.Gamma distribution 2020-06-0610880880Zoom application Click Here
P Gousiya KhanamMathematics1 year A 3The Plane2020-06-062019951995Zoom Video appClick Here
G V BhaskarMathematics2 yearAbstract Algebra Groups2020-06-065040804080Zoom Video appClick Here
P Harshitha Statistics III B.Sc.Vital statistics 2020-06-0610550550Zoom application Click Here
P Harshitha Statistics II B.Sc.Test for two means 2020-06-0610880880Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-06-051817941717Online course, material circulated over WhatsApp Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceArt elements and principles2020-06-05241041.6416.6Assignment -google class roomClick Here
D krishnapriyaHomescienceIII B.Sc Housing and interior decoratinn quiz2020-06-05201050945Google form google class roomClick Here
D krishnapriyaHomescienceIII B.ScNutrition quiz2020-06-052010501050Google form google classroomClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemPothana2020-06-051817941717Online course, material circulated over WhatsApp Here
P Harshitha Statistics I B.Sc.Properties of exponential distribution 2020-06-0510440440Zoom application Click Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) Advantages of market segmentation2020-06-05322887.52887.5Ppts sent to the students through the whatsapp groupsClick Here
Shaik JubedaPhysicsII BSc(MPC&mpcs)Optics wedge shaped air film2020-06-05791215.191215.19Webex meet appClick Here
M venkataramanacommerceIII bcommanagement accounting2020-06-05302066.672066.67ppt in WhatsApp groupClick Here
P Gousiya KhanamMathematics1 year A 3The Plane2020-06-052013651365Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-06-0515320320Zoom Video appClick Here
K.VenugopalaraoCommerceII Fundsflow2020-06-05302583.332583.33Material send to students through WhatsApp groupClick Here
N.DivyasriCommerceI computersFundamental technology2020-06-05302583.332566.67Material send to students through WhatsApp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-06-041817941717Online course, material circulated over WhatsApp Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceArt elements and art principles2020-06-04241875625Google class roomClick Here
D krishnapriyaHomescienceIII B.Sc Housing and interior decoration quiz2020-06-04201050945Google form google class roomClick Here
D krishnapriyaHomescienceIII B.Sc Nutrition quiz2020-06-04201050945Google form google classroomClick Here
P Gousiya KhanamMathematics1 year A 3The Plane2020-06-0420945945Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-06-0410440440Zoom Video appClick Here
P Harshitha Statistics I B.Sc.Uniform distribution with its properties 2020-06-048225225Zoom application Click Here
P Harshitha Statistics III B.Sc.C.S.O and N.S.S.O2020-06-0410770770Zoom application Click Here
P Harshitha Statistics II B.Sc.Large sample test single mean2020-06-0410880880Zoom application Click Here
Ramaraju EZoology III B.SC-Aquaculture clusterDiscus the general awareness on fisheries science quiz2020-06-0429930930Videocal by Google duo appClick Here
K.VenugopalaraoCommerceII Funds flow2020-06-04302583.332583.33Material send to students through WhatsApp groupClick Here
M venkataramanacommerceIII bcomcost accounting2020-06-043015501550WhatsApp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNannaya2020-06-031817941717Online course, material circulated over WhatsApp Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceArt principles2020-06-032418751145Assignment-google class roomClick Here
D krishnapriyaHomescienceIII B.scHousing and interior decoration quiz2020-06-03201050945Google form google classroomClick Here
D krishnapriyaHomescienceIII B.Sc Nutrition quiz2020-06-032010501050Google form googe quizClick Here
Dr. Guntupalli GowriSpecial TeluguII BA (S.H.T) IVth SemVamanavatharam2020-06-031817941717Online course, material circulated over WhatsApp Here
N. BHAGYA RAJUCommerceIII Bcom (G) Venture capital2020-06-03302583.332583.33Ppts sent to the students through the whatsApp GroupsClick Here
M venkataramanacommerceIII bcommanagement accounting2020-06-03302066.672066.67ppt sent to WhatsApp groupClick Here
K.VenugopalaraoCommerceII Problem on ratios2020-06-03302066.672066.67Material send to students through WhatsApp groupClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceMenu plans calculation to different age groups2020-06-032315701570Watsapp groupClick Here
P Gousiya KhanamMathematics1 year A 3The Plane2020-06-032011551155Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-06-0310550550Zoom Video appClick Here
P Harshitha Statistics I B.Sc.Limiting case of binomial and poisson to normal distribution 2020-06-0310660660Zoom application Click Here
P Harshitha Statistics III B.Sc.Official statistics 2020-06-0310770770Zoom application Click Here
P Harshitha Statistics II B.Sc.Poisson and normal distribution (np lemma)2020-06-0310990990Zoom application Click Here
D krishna priyaHousing and interior decorationII B.Sc HomescienceArt elements2020-06-022418751041.6Assignment -google class roomClick Here
D krishnapriyaHomescienceIII Housing and interior decoration2020-06-02201050945Google form google class roomClick Here
D krishnapriyaHomescienceIII B.ScNutrition quiz2020-06-022010501050Google form google classroomClick Here
K.VenugopalaraoCommerceII Financial ratios2020-06-02302583.332583.33Material send to students through WhatsApp groupClick Here
N.DivyasriCommerceI computersEnterprise resource planning risks and benefits2020-06-02302583.332583.33Material send to students through WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking) Economic indicators2020-06-02171588.231588.23Ppts sent to the students through the whatsApp groupsClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Sangraha vyaakyalu2020-06-021817941894shared material through whatsappClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Gosangi 2020-06-02171710017100Class through zoom app and shared study material through WhatsApp group Click Here
P Gousiya KhanamMathematics2 yearSequences2020-06-0215640640Zoom Video appClick Here
P Harshitha Statistics I B.Sc.Areas property of normal distribution 2020-06-0210660660Zoom application Click Here
P Harshitha Statistics III B.Sc.Splicing,deflation of index numbers 2020-06-0210770770Zoom application Click Here
P Harshitha Statistics II B.Sc.Binomial distribution (np lemma)2020-06-0210880880Zoom application Click Here
D krishna priyaHousing and interior decorationII B.Sc HomescienceArt elements2020-06-012418751250Google class roomClick Here
D krishnapriyaHomescienceIII B.ScHousing and interior decoration2020-06-01201050945Google form google classroomClick Here
D krishnapriyaHomescienceIII B.ScNutrition quiz2020-06-012010501050Google form google classroomClick Here
K.VenugopalaraoCommerceIII Ratio analysis2020-06-01302583.332583.33Material send to students through WhatsApp groupClick Here
Shaik JubedaPhysicsII BSc(MPC&mpcs)Optics Resolving power of grating2020-06-01791316.451316.45Webex meet appClick Here
M venkataramanacommerceIII bcomfunds flow statement2020-06-01302066.672066.67ppt in WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &General) Market segmentation2020-06-014030753030Ppts sent to the students through whatsApp groupsClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Doubts clarification 2020-06-0122925.12925.12Doubts clarification through WhatsApp conference callClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Sangraha vyaakyalu2020-06-011817941894Shared material through whatsappClick Here
P Harshitha Statistics I B.Sc.Q.D:M.D:S.D in normal distribution 2020-06-0110770770Zoom application Click Here
P Harshitha Statistics III B.Sc.Chain and fixed based index numbers 2020-06-0110880880Zoom application Click Here
P Harshitha Statistics II B.Sc.Neymann pearsons lemma theorem 2020-06-0110990990Zoom application Click Here
N.DivyasriCommerceI computersEvaluation of ERP2020-05-31302583.332583.33Material send to students through WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (G) Merchant Banking System2020-05-31282487.712487.71PPTs sent to the students through whatsApp groups Click Here
G V BhaskarMathematics1 year A 3Right Line2020-05-3120420420Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-05-3115427427Zoom Video appClick Here
P Harshitha Statistics III B.Sc.Wholesale price index numbers 2020-05-31108801080Zoom application Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Chaamakoru Venkata kavi chematkaara kavitha viseshaalu2020-05-311817941894shared material through whatsappClick Here
P Harshitha Statistics I B.Sc.Mean=median=mode2020-05-312014701470Zoom application Click Here
P Harshitha Statistics II B.Sc.Concepts of Hypothesis 2020-05-31101010010100Zoom application Click Here
M venkataramanacommerceIII bcomcash flow statement2020-05-30302066.672066.67WhatsApp groupClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Endocrine system 2020-05-30221881.561881.56Video lesson sharedClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) Marketing buying decision process2020-05-304030753075Ppts sent to the students through the whatsappClick Here
Shaik JubedaPhysicsII BSc(MPC&mpcs)Optics types of optical fibre s2020-05-30791215.191215.19Webex meet appClick Here
M venkataramanacommerceIIBcomBanking2020-05-30302066.672066.67WhatsApp groupClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)All topics 2020-05-30171482.351482.35Clarified doubts through zoom app and shared study material through WhatsApp group Click Here
Dr Latha B ChemistryII BSc A1, B4, B6NMR spectroscopy: Equivalent and Non-equivalent protons, Chemical shift2020-05-30491020.41020.4Cisco Webex meetingClick Here
G V BhaskarMathematics1 year A 3Right Line2020-05-302011551155Zoom Video appClick Here
G V BhaskarMathematics2 yearSequences2020-05-3015320320Zoom Video appClick Here
P Harshitha Statistics III B.Sc.Cost of living index numbers 2020-05-3031826826Zoom application Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance -scientific and common names2020-05-30262284.62076.92video lesson sharing and discussionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance-scientific names &common names2020-05-30131184.61184.6video lesson sharing through whatsapp &discussionClick Here
P Harshitha Statistics II B.Sc.Testing of hypothesis 2020-05-3010880880Zoom application Click Here
D krishnapriyaHousing and interior decorationII B.Sc Homescience bits2020-05-3024241001875Quiz is framed by using google form and assigned in google classroomClick Here
D Krishna PriyaGeneral psychologyIII B.Sc HomescienceBits2020-05-30201680630Quiz framed by google form and assigned in google classroomClick Here
D Krishna PriyaResource managementIII B.Sc HomesciencePg entrance practice bits2020-05-30201680630Quiz framed by using google forms and assigned in google classroomClick Here
P Harshitha Statistics I B.Sc.M.g.f of normal distribution 2020-05-3010770770Zoom application Click Here
N. BHAGYA RAJUCommerceIII Bcom (G) Fund based and fee based Activities of Financial services2020-05-29282589.292589.29Ppts sent to students through the whatsApp groupsClick Here
P Harshitha Statistics I B.Sc.Properties of normal distribution 2020-05-2931718718Zoom application Click Here
Dr.Guntupalli GowriTeluguII B.A (S.H.T)Vemana sathakam2020-05-291817941794shared material through whatsappClick Here
M venkataramanacommerceIII bcommarginal costing2020-05-29302066.672066.67WhatsApp groupClick Here
P Harshitha Statistics III B.Sc.Criteria of good index numbers 2020-05-293110321032Zoom application Click Here
G V BhaskarMathematics1 year A 3Right Line2020-05-292012601260Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-05-2915533533Zoom Video appClick Here
K.VenugopalaraoCommerceII Valuation of shares problem2020-05-29302583.332583.33Material send to students through WhatsApp groupClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance practice paper-general zoology2020-05-29262284.62076.92whatsapp sharing of video lessonand discussionClick Here
M venkataramanacommerceIIBcom generalincome tax2020-05-293015501550WhatsApp groupClick Here
D krishnapriyaHousing and Interior decorationII B.Sc HomescienceBits2020-05-2924241001979Quiz is framed by using google form and assigned in google classroomClick Here
D krishna priyaGeneral psychologyIII B.Sc HomescienceBits2020-05-29201680525Quiz framed by Google form and assigned in google classroomClick Here
D Krishna priyaResource managementIII B.Sc HomesciencePg entrance practice bits2020-05-29203153100Quiz framed by google forms and assigned in google classroomClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) Marketing Environment2020-05-284028702870Using ppts and sent to the students through the whatsappClick Here
M venkataramanacommerceIII bcomcash flow statement2020-05-28302066.672066.67what's app groupClick Here
M venkataramanacommerceIIBcom generalincome tax2020-05-283015501550WhatsApp groupClick Here
K.VenugopalaraoCommerceII Valuation of shares problem2020-05-28302583.332583.33Material send to students through WhatsApp groupClick Here
P Harshitha Statistics I B.Sc.Normal distribution 2020-05-2839718718Zoom application Click Here
P Harshitha Statistics III B.Sc.Clarification of the index numbers 2020-05-283111351135Zoom application Click Here
G V BhaskarMathematics1 year A 3Right Line2020-05-282011551155Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-05-2815533533Zoom Video appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Sumathi sathakam Badhena2020-05-281817941794shared material through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance practice bits-general zoology2020-05-28262284.62076.92whatsapp sharing and discussionClick Here
D Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceBits2020-05-2824241001979Quiz is framed by using google form and assigned in google classroomClick Here
D Krishna PriyaGeneral psychologyIII B.Sc HomescienceBits2020-05-28201680735Quiz is framed by using google form and assigned in google classroomClick Here
D Krishna PriyaResource managementIII B.Sc HomesciencePg entrance practice bits2020-05-28209459100Quiz framed by using google forms and assigned in google classroomClick Here
N. BHAGYA RAJUCommerceIII Bcom (G) Non Banking Financial companies 2020-05-27322578.122578.12Ppts sent to students through wahtsapp groups Click Here
Shaik JubedaPhysicsII BSc(MPC&mpcs)Optics fibre optics2020-05-27791620.251620.25Webex meet appClick Here
M venkataramanacommerceIII bcommarginal costing2020-05-27302066.672066.67WhatsApp groupClick Here
M venkataramanacommerceIIBcom generalincome tax2020-05-273015501550whatsapp groupClick Here
P Harshitha Statistics III B.Sc.Construction of index numbers 2020-05-2731828828Zoom application Click Here
K.VenugopalaraoCommerceII Valuation of shares2020-05-27302583.332066.67Material send to students through WhatsApp groupClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Sathakasaahithyam visistatha Lakshanaaalu2020-05-271817941794shared material through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance practice paper-general zoology2020-05-27262284.62076.92whatsapp sharing and discussionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance practice paper-general zoology2020-05-27131184.61184.6whatsapp sharing and discussionClick Here
N.DivyasriCommerceI Enterprise resource planning2020-05-27302583.332583.33Material send to students through WhatsApp groupClick Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceBits2020-05-2724241002291Quiz is framed by using google form and assigned in google class roomClick Here
D Krishna PriyaGeneral psychologyIII B.Sc HomescienceBits2020-05-272016801155Quiz is framed by using google form and assigned in google classroomClick Here
D Krishna PriyaResource managementIII B.Sc HomesciencePg entrance practice bits2020-05-27201680315Quiz framed by using google form and assigned in google class roomClick Here
M PadmajaPolitical ScienceI BAPresidential Government features and merits and demerits2020-05-26403587.53587.5WhatsappClick Here
P Harshitha Statistics I B.Sc.Negative binomial distribution Limiting case to PD2020-05-263910261026Zoom application Click Here
K.VenugopalaraoCommerce Share capital2020-05-26302583.332583.33Material send to students through WhatsApp groupClick Here
M venkataramanacommerceIII bcommarginal costing2020-05-263015501550WhatsApp groupClick Here
M venkataramanacommerceIIBcom generalExempted income2020-05-26302066.672066.67pdf in WhatsApp groupClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Koyila2020-05-26171710017100Class through zoom app and shared study material through WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &General) 4ps of marketing2020-05-263022732273Materials send through the whatsApp group's with pptsClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Raghunaada Bhupaluni Prasasthi2020-05-261817941794shared material through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-cells of immune system revision2020-05-26262284.62076.92whatsapp sharing and discussionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumCells of immune system Revision2020-05-26131184.61184.6video lesson and questionare shared through whatsapp and discussionClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterJar and circular hatcheries diagrams2020-05-26291655.171655.17WhatsappClick Here
G V BhaskarMathematics1 year Section - A3Right Line2020-05-262015751575Zoom Video appClick Here
P Gousiya KhanamMathematics2 yearSequences2020-05-2615533533Zoom Video appClick Here
D krishnapriyaHousing and interior decorationII B.Sc HomescienceBits2020-05-26242410024100Quiz is framed by using google form and assigned in google class roomClick Here
D krishnapriyaGeneral PsychologyIII B.Sc HomescienceBits2020-05-262016801575Quiz is framed by ising google form and assigned in google classroomClick Here
D krishnapriyaResource managementIII B.Sc HomesciencePg entrance Practice bits2020-05-26201680945Quiz framed by using google form and assigned in google classroomClick Here
M venkataramanacommerceIIBcomcommercial bank2020-05-253015501550WhatsApp groupClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking) Fundamental Analysis2020-05-25181583.331583.33Providing material through the whatsapp groups with pptsClick Here
G.sita Electronics 3 BSC MECS (CIUSTER)Getting embedded system into target system 2020-05-25111110011100YouTube link shared through WhatsApp group Click Here
Ramaraju EZoology III B.SC-Aquaculture clusterBrackish water fishes2020-05-25291034.481034.48Google duo appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)vachana kavya rachana parinaamam2020-05-251817941794shared material through whatsappClick Here
M venkataramanacommerceIII bcomBreak even chart2020-05-25302066.672066.67WhatsApp group pdfClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Koyila2020-05-25171710017100Shared study material through WhatsApp group Click Here
Dr.G.Swarna LathaTelugu3rd BASHTNamnikaranam2020-05-25141410014100Material through Whats AppClick Here
P Harshitha Statistics III B.Sc.Index numbers 2020-05-2531930930Zoom application Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Types of immunity2020-05-25262284.62076.92video lesson aand assignment shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumImmunology-Types of immunity2020-05-25131184.61184.6whatsapp sharing and discussionClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Circulation 2020-05-25221881.561881.56WhatsApp group YouTube links shared Click Here
G V BhaskarMathematics2 yearSequences2020-05-2515426426Zoom Video appClick Here
P HarshithaStatisticsI B.Sc. M.c.c.q. on unit I and unit II2020-05-253914361436Zoom applicationClick Here
D Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceBits2020-05-2524241002291.6Quiz is framed by using google form and assigned in google classroomClick Here
D Krishna priyaGeneral PsychologyIII B.Sc HomescienceBits2020-05-2520168016100Quiz is framed by using google form and assigned in google classroomClick Here
D KrishnaproyaResource managementIII B.Sc HomescienceBits2020-05-25201680420Quiz framed by using google form and assigned in google classroomClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara Saasthram - Bharatheeya alankaarikulu2020-05-24141285.711285.71Whats app groupClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)yakshagaanaalu2020-05-241817941794shared material through whatsappClick Here
P Harshitha Statistics I B.Sc.Mcqs given on expectations and discrete distributions2020-05-2439718718Zoom application Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Koyila(adhunika padhyabagham)2020-05-24171710017100Class through zoom app and shared study material through WhatsApp Click Here
G V BhaskarMathematics1 year Section - A3Right Line2020-05-242016801680Zoom Video appClick Here
G V BhaskarMathematics2 yearSequences2020-05-2415427427Zoom Video appClick Here
N. BHAGYA RAJUCommerceIII Bcom (G) Importance of Financial Sevices2020-05-242520802080Material send to students through the whatsapp group with pptClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara Saasthram - Drusya Kaavyaalu2020-05-23141285.711285.71What's app groupClick Here
P Harshitha Statistics I B.Sc.Negative binomial distribution 2020-05-233913331333Zoom application Notes explanation Click Here
Dr.Guntupalli GowriTelugu II B.A(S.H.T)Naayaka Rajula Paalana lo Sahithyam2020-05-231817941794shared material through whatsappClick Here
M venkataramanacommerceIII bcomratio analysis2020-05-234030752562.5 material issued whats up groupClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Koyila2020-05-23171710017100Class through zoom app and shared study material through WhatsApp Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Explanation of Salt water phase diagram 2020-05-23491020.41020.4Revision by lecture method through Cisco Webex meetingClick Here
M venkataramanacommerceIIBcom generaltotal income2020-05-23302066.672066.67whats up groupClick Here
Dr.G.Swarna LathaTelugu3rd BASHTNamnikaranam2020-05-23141410014100Material through Whats AppClick Here
N.BhagyarajuCommerceIII Marketing mix2020-05-23302583.332066.67Material send to students through WhatsApp groupClick Here
N.DivyasriCommerceIII Vouching2020-05-23302583.332583.33Material send to students through WhatsApp groupClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Embryology 2020-05-23221881.561881.56WhatsApp group YouTube links shared Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance General zoology2020-05-23262284.62076.92whatsapp sharing and discussionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance General zoology2020-05-23131184.61184.6whatsapp sharing of vlesson and discussionClick Here
G V BhaskarMathematics1 year Section - A3Right Line2020-05-234018451845Zoom Video appClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-2315533533Zoom Video appClick Here
M venkataramanacommerceIIBcom computerExIM bank2020-05-223015501550WhatsApp groupClick Here
M venkataramanacommerceIII bcomcash flow statement2020-05-22302066.672066.67WhatsApp groupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram -Drusya Kaavyaalu2020-05-22141410014100What's app groupClick Here
G.sita Electronics 1 BSC MECSGiven assignment on mosfet 2020-05-22302583.332583.33Assignment given through WhatsApp group Click Here
M PADMAJAPolitical ScienceI BAParliamentary Government features in India2020-05-22604066.674066.67Lecture method through whatsappClick Here
M PADMAJAPolitical ScienceIII BAQuiz to III BA students2020-05-22161487.51487.5WhatsappClick Here
Shaik jubedaPhysicsII BSc(MPC&mpcs)Thermister2020-05-22791721.521721.52Webex meet appClick Here
K.VenugopalaraoCommerceI Partnership accounts2020-05-2230301002583.33Material send to students through WhatsApp groupClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Pb Ag system and discussion on IR spectroscopy with MCQs2020-05-22491224.51224.5Cisco webex meetingClick Here
Dr Latha B ChemistryII BSc A1, B4, B6UV spectroscopy for entrance2020-05-2211327.3327.3Cisco webex meetingClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance Respiratory system2020-05-22262284.62076.92Content and question paper shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance Respiratory system2020-05-22131184.61184.6Google duo discussionClick Here
N.DivyasriCommerceIII Auditing2020-05-22302066.672066.67Material send to students through WhatsApp group with pptClick Here
N.BhagyarajuCommerceIII Marketing2020-05-22302066.672066.67Material send to students through WhatsApp groupClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterChinese carps2020-05-2229517.24517.24Online video class by Google duo app Click Here
Dr.Guntupalli GowriTelugu II B.A(S.H.T)Madhuraanthakam Raja ram2020-05-221817941794shared material through whatsappClick Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS)Problems in fundamental of vibrations 2020-05-22701115.71115.7Webex meet Click Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-2215427427Zoom Video appClick Here
P HarshithaStatisticsI B.Sc. Hyper Geometric Distribution2020-05-223912311231Zoom applicationClick Here
M venkataramanacommerceIII bcomcash flow statement2020-05-21302066.672066.67WhatsApp groupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Sravya Kaavyaalu2020-05-21141285.711285.71What's app groupClick Here
G.sita Electronics 1 BSC MECSDoubts clarification of fet2020-05-2130310310Webex meet Click Here
P Harshitha Statistics I B.Sc.Hypergeometric distribution 2020-05-213912311231Zoom application Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Sivaraju pattabishekam2020-05-21171710017100Class through zoom app and shared study material through WhatsApp Click Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS)Fourier theorem-- evaluation of Fourier coefficients 2020-05-217014201420Webex meet Click Here Planning in India2020-05-21302583.332583.33Material send to students through WhatsApp groupClick Here
DorkaBiochemistryI BSc BiochemGOOGLE CLASSROOM2020-05-2122151006345Material through Google ClassroomClick Here
DorkaBiochemistryIII BSc BiochemGoogle Classroom2020-05-2114964750Material / Video through Google classroomClick Here
MADASU LAKSHMI HIMA BINDHUMicrobiologyIII MBC&MZCVirology2020-05-21241562.51562.5Quiz for pg entrance coachingClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterCultivable barakish water fishes assignment2020-05-21291137.931137.93Whatsap assignment Click Here
Dr.G.Swarna LathaTelugu3rd BASHTSamyukta Vaakyam2020-05-21141410014100Material through Whats AppClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Frog development 2020-05-21221881.561881.56WhatsApp group YouTube links shared Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance practice paper-Human heart2020-05-21262284.62076.92video lesson aned question paper shared through whatsapp and discussedClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance practice paper-Human heart2020-05-21131184.61184.6question paper shared through whatsappClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Phase rule and Water phase system2020-05-21491020.41020.4Webex meetingClick Here
Dr.Guntupalli GowriTelugu II B.A(S.H.T)Rachayathri Kanaparthi Varalakshmamma2020-05-211817941794shared material through whatsappClick Here
G V BhaskarMathematics1 year Section - A3Right Line2020-05-214015711571Zoom Video appClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Sivaraju pattabishekam2020-05-20171710017100Shared study material through WhatsApp group Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)kavi Potlapalli Ramarao2020-05-201817941894shared material through whatsappClick Here
K.VenugopalaraoCommerce Planning in India2020-05-20302583.332066.67Material send to students through WhatsApp groupClick Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS) Detection methods,Sears method,applications of Ultrasonics 2020-05-20701724.21724.2Webex meet Click Here
Ramaraju EZoology III B.SC-Aquaculture clusterIMC2020-05-2029310.13310.13Online video class by Google duo appClick Here
Dr.G.Swarna LathaTelugu3rd BASHTSamslista Vaakyam2020-05-20141410014100Material through Whats AppClick Here
P Harshitha Statistics I B.Sc.Mathematical Expectations 2020-05-203913341334Zoom application Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CHypersensitivity 2 marks questions exam2020-05-20262284.62076.92video lesson and question paper shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumHypersensitivity 2 marks questions exam2020-05-20131184.61184.6WHATSAPPClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Embryology 2020-05-20221881.561881.56WhatsApp group YouTube links shared Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Vanthoffs theory and significance of vanthoffs factor2020-05-20491224.51224.5Cisco webex meeting for virtual classClick Here
Dr Latha B ChemistryIII BSc Clusterfollowup and updates about PG entrance preparation2020-05-2011545.45545.45Virtual discussion through Cisco Webex meetingClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-2015533533Zoom Video appClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Gadya Kaavyaalu2020-05-20141285.711285.71What's app group Click Here
G.sita Electronics 1 BSC MECSEnhancement mosfet 2020-05-20302583.332583.33Lesson material shared through WhatsApp group Click Here
Shaik jubedaPhysicsII BSc(MPC&mpcs)Optics Applications of lasers2020-05-20791417.721417.72Webex meet appClick Here
M.IndirammaEnglishI.BScCorrection of sentence2020-05-2025832832Zoom appClick Here
M.IndirammaEnglishII BANote making2020-05-2028828.57828.57WebEx meetClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterInduced breeding2020-05-19291655.171655.17WhatsApp communucationClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Sravya Kaavyaalu2020-05-19141285.711285.71What's app groupClick Here
G.sita Electronics 1 BSC MECSMosfet 2020-05-19302583.332583.33Lesson material shared through WhatsApp group Click Here
P Harshitha Statistics I B.Sc.Geometric distribution 2020-05-193914361436Zoom application Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Sivaraju pattabishekam2020-05-19171710017100Class through zoom app and shared study material through WhatsApp Click Here
K.VenugopalaraoCommerceI Planning in India2020-05-19302583.332066.67Material send to students through WhatsApp groupClick Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS) Magnetostriction,Piezoelectric methods 2020-05-19701521.41521.4Webex meet Click Here
G V BhaskarMathematics1 year Section - A3The Cylinder2020-05-194022552255Zoom Video appClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-1915533533Zoom Video appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)GUdipati Venkata Chalam2020-05-191817941894shared material through WhatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CHyperssensitivity type 12020-05-19262284.62076.92video lesson shared through whatsapp and discussedClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumHypersensitivity type 12020-05-19131184.61184.6video lesson shared through whatsappClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Osmotic pressure colligative nature and its experimental determination2020-05-19491326.51326.5Revising concepts through webex meeting and assignment submission through watsappClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Gadya Kaavyaalu2020-05-18141285.711285.71What's app groupClick Here
G.sita Electronics 1 BSC MECSField effect transistor 2020-05-18302583.332583.33Lesson material shared through WhatsApp group Click Here
P Harshitha Statistics I B.Sc.Properties of poisson distribution 2020-05-183912311231Zoom application Click Here
Shaik jubedaPhysicsII BSc(MPC&mpcs)Optics Helium Neon laser2020-05-18791620.251620.25Webex meet appClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Depression in freezing Point and its experimental determination2020-05-18491228.61228.6CiscoWebex and WatsappClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)kathaanika Lakshanalu Mariyu Kavi Subramanya Sastry garu2020-05-181817941794shared material through whatsappClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Sivaraju pattabishekam2020-05-1817635.29635.29Class through zoom app Click Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS)Amplitude resonance velocity resonance 2020-05-187014201420Webex meet Click Here
M.IndirammaEnglishII BACSS2020-05-18281035.71828.57WebEx meetClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.Cimmunology - Major histocompatability complex2020-05-18262284.61869.23Discussion through Google duoClick Here
G V BhaskarMathematics1 year Section - A3The Cylinder2020-05-184018451845Zoom Video appClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-1815640640Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumImmunology-MHC2020-05-18131184.61184.6WHATSAPP SHARINGClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterIMC assignment2020-05-18291448.281448.28Assignment assign by whatsap proClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Anibaddha Kaavyaalu2020-05-17141410014100What's app groupClick Here
G V BhaskarMathematics1 year Section - A3The Cylinder2020-05-174021532153Zoom Video appClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-1715747747Zoom Video appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)kathaanika Upodgaatham2020-05-171817941794shared material through whatsapp Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Elevation in the Boiling Point2020-05-17491224.51224.5Cisco Webex and WatsappClick Here
P Harshitha Statistics I B.Sc.Poisson distribution 2020-05-1739924939Zoom application Click Here
Dr.G.Padmini DeviDiet therapyII B.Sc HomescienceCholecystitis and cholelithiasis2020-05-162417701458 Remedial class by whatsapp groupClick Here
DorkaBiochemistryIII BSc BiochemAlzheimers2020-05-161414100857Assignment through Google ClassroomClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Anibaddha Kaavyaalu2020-05-16141285.711285.71What's app groupClick Here
Dr. B.D.J.SATYA LATHAZOOLOGYII B.Sc. C2ECOLOGY2020-05-16221777.121777.12you tube links shared through whats app groupClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterDiscus the model paper of aquaculture management2020-05-16291344.841344.84Two online video classes by Google duo app Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Vedam Venkata Raya Sastry2020-05-161817941794shared material through whatsapp and conucted meeting through Go to meeting APPClick Here bankingNegotiable instruments2020-05-16302583.332066.67Material send to students through WhatsApp groupClick Here
B.Swetha Rani BaiProjectIII B.Sc Home scienceBits preparation on nutrition2020-05-162015951595Watsapp groupClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Sivaraju pattabishekam2020-05-16171710017100Shared study material through WhatsApp group and video class through zoom app Click Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS)Different equation of forced harmonic oscillator 2020-05-167014201420Webex meet Click Here
Dr.G.Swarna LathaTelugu3rd BASHTSamslista Vaakyam2020-05-16141410014100Material through Whats AppClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-PG Entrace practice paper IX-IMMUNODEFICIENCY2020-05-16262284.62076.92Question paper shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance practice paper ix2020-05-16131184.61184.6question paper shared through whatsappClick Here
G V BhaskarMathematics1 year Section - A3The Cylinder2020-05-164021532153Zoo Video appClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-1615747747Zoom Video appClick Here
D.KrishnapriyaGeneral PsychologyIII B.Sc HomescienceEmotional intelligence-domains and emotional competence2020-05-1520201001365Remedial class by whatsapp grpupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Rasa Dhwani2020-05-15141285.711285.71what's app groupClick Here
G.sita Electronics 1 BSC MECSPhoto electric devices2020-05-15302583.332583.33Lesson material shared through WhatsApp group Click Here
Shaik jubedaPhysicsII BSc(MPC&mpcs)Optics Boys method2020-05-15791417.71417.7Webex meetClick Here
M.IndirammaEnglishI.BScCorrection of sentence2020-05-1525936728ZoomClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterPaper 1 practical model paper discus2020-05-1529827.57827.57Online video class by Google duo appClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterPaper 1 practical model paper discus2020-05-1529827.57827.57Online video class by Google duo appClick Here
P Harshitha Statistics I B.Sc.Binomial distribution Limiting cases2020-05-153910261026Zoom application Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Lowering of vapour pressure2020-05-15491224.51224.5Webex and WatsappClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Tirupati venkata kavulu naatakaalu2020-05-151817941794shared material through whatsappClick Here
K.VenugopalaraoCommerceII Business Law 2020-05-15302686.672583.33Material send to students through WhatsApp groupClick Here
G V BhaskarMathematics1 year Section - A3The Cone2020-05-154020502050Zoom Video appClick Here
G V BhaskarMathematics2 yearContinuous Functions2020-05-1515640640Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-PG Entrance practice paper VIII2020-05-15262284.62076.92Question paper shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumImmunology-PG Entrace practice paper VIII Vaccines2020-05-15131184.61184.6whatsapp sharing and discussionClick Here
N Rajya LakshmiComputer ScienceIII BComE-Commerce2020-05-15262610026100Google formClick Here
M.IndirammaEnglishII BACSS2020-05-152814501450WebEx meetClick Here
Dr.G.Swarna LathaTelugu3rd BASHTSaamanya Vaakyam2020-05-15141410014100Material through Whats AppClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)Logic families2020-05-153027902790Whatsapp material sharingClick Here
D.Krishna PriyaResource managementIII B.Sc HomescienceTypes and steps in making time schedule2020-05-1420201001470Remedial class by whatsapp groupClick Here
DrBDJ Satya lathaZoologySecond yearc2Ecology2020-05-14171777.771777.77Assignment topic given through WhatsApp groupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Alankaara Dhwani2020-05-14141410014100What's App groupClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Tirupati venkata kavulu Kavi Parichayam2020-05-141817941794shared material through whatsappClick Here
G.sita Electronics 1 BSC MECSPhoto electric devices2020-05-1430413.33413.33Webex meet Click Here Banking and financial institutions quiz answers2020-05-14202010020100Answers shared through WhatsApp groupClick Here
M.IndirammaEnglishI.BScRemedial class2020-05-1425936936Zoom appClick Here
Dr.Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Respiration-Krebs cycle2020-05-1422836.36836.36Lecturer method through Zoom AppClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Neethi sathakam dhairya paddathi 2020-05-1417529.41529.41Class through zoom app Click Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS)Logarithmic decrement,relaxation time quality factor 2020-05-14701927.41927.4Webex meet Click Here
Dr.K.Anita KumariGrowth and development during life spanI B.Sc Home SciencePrinciples of growth and development2020-05-143020902090Remedial classes through watsapp groupClick Here
G V BhaskarMathematics1 year Section - A3The Cone2020-05-144023582358Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-05-1415853853Zoom Video appClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceIodine deficiency disorders2020-05-142216701670Remedial classes through watsapp groupClick Here
M.IndirammaEnglishII BACSS2020-05-14281035.711035.71WebEx meetClick Here
Dr.G.Swarna LathaTelugu3rd BASHTSaamanya Vaakyam2020-05-14141410014100Material through Whats AppClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu Mediumcytokines2020-05-14131184.61184.6video presentation shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.Ccytokines2020-05-14262284.62076.92whatsapp sharingClick Here
Dr. VijayaBabu Koganti Communicative English IB.A CE Tenses 2020-05-14551005100CLT worksheet teleconference Click Here
Dr. VijayaBabu Koganti CSS EnglishB.A B.COM B.SCWriting Resume and Cover Letter 2020-05-14424210042100Google Classroom Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Dilute solutions2020-05-1449816.3816.3Cisco webex and watsappClick Here
N Rajya LakshmiComputer ScienceIII BComPHP2020-05-14262610026100GoogleClassroomClick Here
DorkaBiochemistryI BSc BiochemATCase2020-05-13221359940Assignment through Google classroomClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Vasthu Dhwani2020-05-13141410014100What's app groupClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CTypes of vaccines2020-05-13262284.62076.92video lesson prepared and shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumTypes of vaccines2020-05-13131184.61184.6video lesson shared through whatsappClick Here
G.sita Electronics 1 BSC MECSTransistor biasing methods 2020-05-13302583.332583.33Screen sharing through WhatsApp group Click Here
M PadmajaPolitical ScienceIII BAGlobalization2020-05-131612751275Globalization through whatsappClick Here
DrBDJ Satya lathaZoologySecond yearc2Physiology mcqs2020-05-13221781.831781.83You tube links are shared through WhatsApp groupClick Here
P Harshitha Statistics I B.Sc.Properties of binomial distribution 2020-05-133914361436Zoom application Click Here
M.IndirammaEnglishI.BScRemedial class2020-05-1325312012ZoomClick Here
M.Kamala KarunachemistryIB.Scliquid crystals2020-05-1353611.3611.3explained topic with Webex meeting, sent the ppt through whatsappClick Here
Shaik jubedaPhysicsII BSc(MPC&mpcs)Optics Ruby Laser2020-05-13791518.981518.98Webex MEET appClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterAquaculture econamics2020-05-13291344.831344.83Two classes by Google duo app Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Dharmavarapu Subramanyam maroo moodu natakaalu2020-05-131817941794shared material through whatsapp Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Paropakaara paddathi 2020-05-1317317.64317.64Class through zoom app Click Here
Prasanthi DaniePhysics 1 BSC (MPC AND MPCS)Different equation of damped harmonic oscillator 2020-05-13701522.41522.4Webex meet Click Here
Dr S L B SANKARA SARMASanskritI year II Semester गङ्गावतरणम्2020-05-1310880880Zoom appClick Here
Dr.S.PriyankaBiotechnologyII B.ScImmunology2020-05-138450450Whats upClick Here
G V BhaskarMathematics1 year Section - A3The Cone2020-05-134022552255Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-05-1315853853Zoom Video appClick Here
Dr. Vijaya Babu KogantiCommunicative English PII I B.ATenses 2020-05-13441004100CLT worksheet teleconference Click Here
Dr. Vijaya Babu Koganti CSSB.A/ B.Com/B.ScWriting Resume and Cover Letter 2020-05-13424210042100Google Classroom Click Here
Dr Latha B ChemistryII BSc A1, B4, B6NMR spectroscopy2020-05-13491530.61530.6Cisco Webex and WatsappClick Here
Dr. N. Manjula BharathiPhysicsIII B. Sc(MPC)Op. Amp2020-05-133735953595Whatsapp material sharingClick Here
Dr.K.Anita KumariTraining and HRDIII B.Sc Home scienceFormulating objectives and characteristic2020-05-132015901590Remedial classes through watsapp groupClick Here
B.Swetha Rani BaiFood ScienceI B.Sc Home SciencePigments present in fruits 2020-05-133010801080Remedial classes through watsapp groupClick Here bankingBanking and financial institutions quiz2020-05-13202010020100Quiz question bit bank shared through WhatsApp groupClick Here
D Vijaya SreeBiochemistryII B4, B6Degradation of purines2020-05-1315426426Remedial by whatsappClick Here
D.KrishnapriyaHousing and Interior decorationII B.Sc HomescienceDefine fatigue write in detail about forms of fatigue2020-05-122418751458Remedial class by whatsappClick Here
Dr.G.Padmini DeviFundamentals of family nutritionIB.Sc HomescienceNutritional requirements and nutritional problems of school children2020-05-123018601550Remedial class by whatsapp groupClick Here
DorkaBiochemistryIII BSc BiochemMolecular Chaperones2020-05-121414100643Assignment through Google ClassroomClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Rasaabhaasamu2020-05-12141285.711285.71Through What's App GroupClick Here
Dr S L B SANKARA SARMASanskritI year II Semester पुष्पोद्भवचरितम्।2020-05-122220902090Zoom appClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Bathruhari neethi sathakamu lo sujana paddathi2020-05-12171482.351482.35Study Material shared through WhatsApp groupClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Dharmavarapu Subramanyam moodu natakaalu2020-05-121817941794shared material through whatsapp and conducted meeting on Go to meeting appClick Here
Dr.Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Respiration- Glycolysis2020-05-1222836.36836.36Lecturer method through Zoom AppClick Here
Dr. N. Manjula BharathiPhysicsIII B. Sc(MPC)Op. Amp2020-05-1237924.3924.3Webex meet screen sharingClick Here
N Rajya LakshmiComputer ScienceIII Bsc Clusteronline quiz in PHP2020-05-12111110011100WHATSAPPClick Here
G V BhaskarMathematics1 year Section - A3The Cone2020-05-124022552255Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-05-1215747747Zoom Video appClick Here
P Harshitha Statistics I B.Sc.Binomial distribution 2020-05-123912311231Zoom Click Here
Ramaraju EZoology III B.SC-Aquaculture clusterFisheries education2020-05-122918621862Assignment assign and received by whatsappClick Here
Dr Latha B ChemistryII BSc A1, B4, B6NMR spectroscopy2020-05-12491224.51224.5CiscowebEx and WatsappClick Here
Dr. Vijaya Babu CSSB.A/B.COM/B.SCWriting Resume and Cover Letter 2020-05-12424210042100CLT- Google Classroom Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance General zoology2020-05-12262284.62076.92whatsapp sharing and discussionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance General zoology2020-05-12131184.61184.6whatsappClick Here
Prasanthi DainePhysics 1 BSC (MPC AND MPCS)Transverse vibrations of bars2020-05-12701622.81622.8Webex meet Click Here
Dr. Vijaya Babu Koganti Communicative English I B.A CE Tenses revision2020-05-12441004100CLT worksheet teleconference Click Here
Dr.Vijaya Babu Koganti CSSB.A/ B.COM B.SCWriting Resume and Cover Letter 2020-05-12424210042100Google Classroom Click Here
G V S PRANAYANI DEVICOMPUTER SCIENCECLOUD COMPUTINGProblem solving techniques in programming2020-05-1222627.27627.27Zoom video appClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Abhivyakthi Vadamu2020-05-11141410014100Through What's App GroupClick Here
G.sita Electronics 1 BSC MECSRelation between current amplification of BJT 2020-05-11302583.332583.33Screen sharing through WhatsApp group Click Here
P Harshitha Statistics I B.Sc.Mathematical Expectations2020-05-113912311231Zoom application Click Here
M PADMAJAPolitical ScienceI BADirect Democracy2020-05-112515601560Study material given through whatsappClick Here
Dr.Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Nitrogen mETABOLISM-bIological Nitrogen fixation2020-05-1122627.27627.27Lecture method Zoom AppClick Here
M venkataramanacommerceIII bcomfunds flow statement2020-05-113015501550whats up groupClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Dharmavarapu Krishnamaacharyulu Kaviparichayam2020-05-111817941794lecture method through whatsapp meeting conducted through Go to meeting APPClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterFish marketing methods assignment 2020-05-112918621862WhatsApp informationClick Here
Dr.G.Swarna LathaTelugu3rd BASHTTelugu Vaakyam2020-05-11141410014100Material through Whats AppClick Here
Dr S L B SANKARA SARMASanskritI year II Semester Vyakaranam2020-05-1110880880Zoom appClick Here
N Rajya LakshmiComputer ScienceII Bscdata structures2020-05-11262610026100google class room & whats AppClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Bathruhari neethi sathakamu 2020-05-1117423.52423.52Class through zoom app Click Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceIron deficiency anemia2020-05-1122618618Remedial classes through watsapp groupClick Here
K.VenugopalaraoCommerceI Depreciation problem2020-05-11302583.332583.33Problem given to students through WhatsApp groupClick Here
Prasanthi DainePhysics 1 BSC (MPC AND MPCS)Longitudinal vibrations of fixed fixed free free bars2020-05-117014201420Webex meet Click Here
G V BhaskarMathematics1 year Section - A3The Cone2020-05-114019481948Zoom Video apClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-05-1115533533Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-systamic autoimmune diseases2020-05-11262284.62076.92video lesson and question paper shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumImmunology-systamic autoimmune diseases2020-05-11131184.61184.6whatsappClick Here
Dr.G.Padmini DeviApparel and MerchandisingIII B.Sc HomescienceElements and techniques of visual merchandising2020-05-1120201001575Remesial class by whatsappClick Here
D UmaBotanyI BscAnamolous secondary growth2020-05-1125520520PPT by zoomClick Here
Dr. Vijaya Babu KogantiCSSB.A/B.Com/B.ScWriting Resume and Cover Letter2020-05-11393910039100CLT GOOGLE CLASSROOM Click Here
Dr. Vijaya Babu Koganti Communicative English I B.A CE Tenses2020-05-11441004100CLT worksheet teleconference Click Here
DorkaBiochemistryI BSc BiochemPhosphorylation, Zymogen Activation2020-05-10221359940Assignment through Google ClassroomClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Bhukthivadamu2020-05-10141410014100Through What's app groupClick Here
SHAIK JUBEDAPHYSICSII BSc mpc and mpcsOptics lasers2020-05-10791113.91113.9Jitsi meet app Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Vemana sandarbhasahitha vyakhyalu 2020-05-1017423.52423.52Class through zoom app Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Chemical shift and spin spin coupling2020-05-10491020.41020.4Cisco Webex and WatsappClick Here
G V BhaskarMathematics1 year Section - A3The Cone2020-05-104021532153Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-05-1015960960Zoom Video appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Naatakam Upodgaatham2020-05-101817941794shared material through whatsapp. Meeting conducted in Go to meeting appClick Here
Dr. VijayaBabu KogantiCSSB.A/B.COM/B.SCWriting Resume and Cover Letter2020-05-10363610036100CLT GOOGLE CLASSROOM Click Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Kodavatiganti kutumba rao garu navalaaa visleshana2020-05-091817941794lecture method through whatsapp meeting through go to meeting appClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram -Anumithivadamu2020-05-09141410014100Through Whats app groupClick Here
G.sita Electronics 1 BSC MECSSwitch mode power supply 2020-05-09302583.332583.33Material shared through WhatsApp group Click Here
M.IndirammaEnglishI.BScRemedial class2020-05-09251144832Zoom appClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterFish marketing methods2020-05-09291344.841344.84Two sessions video classes by Google duo appClick Here
Naga Prasanna. MZoology III yr Aquaculture clusterAdvanced methods of fish preservation 2020-05-0929514.47514.47Remedial class through Google duo Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Vemana mooksha reethulu 2020-05-0917529.41529.41Class taken through zoom app Click Here
Dr S L B SANKARA SARMASanskritI year B. Com. II Semester कृषिफलम्2020-05-0910990990zoom appClick Here
N Rajya LakshmiComputer ScienceIII BComBussiness to Bussiness Models2020-05-0926935935WhatsAppClick Here
Dr.G.Swarna LathaTelugu3rd BASHTVibhakti Kriyanvayam2020-05-09141410014100Material through Whats AppClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.Ccurrent affairs for competative exams2020-05-09262284.62076.92whasapp sharing and discussion Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu Mediumcurrent affairs for competative exams2020-05-09131184.61184.6whatsapp sharing and discussionClick Here
B.Swetha Rani BaiProjectIII B.Sc Home scienceMCQS on disease conditions symptoms2020-05-0920515515Remedial classes through watsapp groupClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-094023582358Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0915960960Zoom Video appClick Here
Dr. Vijaya Babu KogantiCommunicative English PII I B.ATenses2020-05-09441004100CLT WORKSHEET TELECONFERENCE Click Here
Dr.K.SucharitaMicrobiologyI BSc Revision of topics Chemistry of aminoacids and proteins2020-05-095436663666Zoom whatsapp Google classroomClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Question papers2020-05-0922422.12422.12ZoomClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-1 B2 B4Zoogeographic realms2020-05-09625289.665289.66WhatsApp group YouTube links sharedClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Principle of NMR spectroscopy2020-05-09491224.51224.5Cisco webex and watsappClick Here
P Harshitha Statistics I B.Sc.Mathematical Expectations2020-05-093917441744Zoom application Click Here
Prasanthi DainePhysics 1 BSC (MPC AND MPCS)Velocity of longitudinal wave in a bar 2020-05-09701622.81622.8Webex meet Click Here
Dr.G.Padmini DeviDiet therapyII B.Sc HomescienceLiver cirrhosis2020-05-09242291.61562.5Remedial class by whatsappClick Here
Dr.G.Padmini DeviFamily meal managementI B.Sc HomescienceNutritional requirements and problems of preschool children2020-05-09302066.61550Remedial class by whatsapp groupClick Here
G V S Pranayani DeviCOmputer ScienceCloud ComputingProblem Solving2020-05-0922627.27627.27Zoom AppClick Here
G.sita Electronics 1 BSC MECSHalf wave and full wave rectifier 2020-05-0830413.3326.67Webex meet Click Here
SHAIK JUBEDAPHYSICSII BSc mpc and mpcsOptics system matrix for the combination of thin lenses2020-05-087919241924Jitsi meet app Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)Flip flops2020-05-083735943594Whatsapp material sharingClick Here
P Harshitha Statistics I B.Sc.Mathematical Expectations 2020-05-083917441744Zoom application Click Here
M.IndirammaEnglishI.BScVoice2020-05-0825936936Zoom appClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Vemana kavitha reethulu2020-05-08171376.471376.47Shared study material through WhatsApp groupClick Here
Naga Prasanna. MZoology III yr Aquaculture clusterTraditional methods of preservation 2020-05-0829444.4444.4Remedial class through Google DuoClick Here
Dr. Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Mineral Nutition in plants2020-05-08221045.51045.5Lecturer method through Zoom AppClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterDiagnosis and health management of fishes2020-05-08291551.781551.78Two sessions online video classes by Google duo appClick Here
Dr.G.Swarna LathaTelugu3rd BASHTSamapaka Asamapaka Kriyalu2020-05-08141410014100Material given through Whats AppClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance-8-model exam2020-05-08262284.62076.92question paper shared through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPGCET MATERIAL2020-05-08131184.61184.6Material shaed through whatsappClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-084031783178Zoom Video appClick Here
G V BhaskarMathematics1 year Section - A6The Plane2020-05-081511731173Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0815747747Zoom Video appClick Here
G V BhaskarMathematics3 yearOrthogonality2020-05-083510291029Zoom Video appClick Here
Dr. Vijaya Babu KogantiCommunicative English I B.A CETenses2020-05-08551005100Participative through worksheet TeleconferenceClick Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Question papers2020-05-08221883.561883.56Whatspp group YouTube links sharedClick Here
Dr.K.SucharitaMicrobiologyIIIBScMSc entrance Transcription and translation2020-05-083316481545Explanation through Zoom PPT sharing through whatsapp and Google classroomClick Here
DorkaBiochemistryIII BSc BiochemMALDI-ESI2020-05-081414100536Assignment through Google Classroom Click Here
D.Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceErgonomics-aspects and principles2020-05-08242291.61562.6Remedial class by whatsappClick Here
D.Krishna priyaGeneral PsychologyIII B.Sc HomescienceDeviations of intelligence -subnormal and the gifted2020-05-0820201001575Remedial class by whatsappClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Kodavatiganti kutumba rao garu 2020-05-081817941794shared lesson material through whatsappClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Uthpatthi vadam2020-05-08141410014100Lesson material shared through What's App GroupClick Here
D UmaBotanyIII B5Gene transfer methods2020-05-079556556PPT, through zoomClick Here
D.Krishna PriyaResource managementIII B.Sc HomescienceDefine timeplan.Write the steps in making timeplan2020-05-0720201001470Remedial class by whatsappClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Vyabhichari bhavaalu2020-05-07141410014100Lesson material shared through What's App groupClick Here
M PADMAJAPolitical ScienceI BADemocracy2020-05-072515601560Study material shared through whatsappClick Here
Dr.K.SucharitaMicrobiologyI BScRevision class carbohydrates2020-05-075432603055Zoom PPT WhatsappClick Here
Dr.K.SucharitaMicrobiologyIIIBScMSc entrance classification structure and functions of carbohydrates2020-05-073316481648zoom whatsappClick Here
G.sita Electronics 3 BSC MECS (CIUSTER)Embedded system custom single purpose processor 2020-05-07111090.911090.91Notes given through WhatsApp Click Here
Dr.Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Plant physiology and metabolism-plant water relations-Enzymes2020-05-0722940.9940.9Lecturer method through Zoom AppClick Here
Naga Prasanna. MZoology III yr Aquaculture clusterTips to identify freshness of fish and need of preservation 2020-05-0729310.34310.34Remedial class through WhatsApp Click Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Vemana hetuvadha drukpadham2020-05-0717635635Class through zoom app Click Here
Dr S L B SANKARA SARMASanskritI year B. Com. II Semester Vasistasrama gamanam2020-05-0710990990Zoom appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Viswanadha Satyanarayana garu navala rachanalu2020-05-071817941794shared material through whatsappClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Flip flops2020-05-0767913913Webex meet screen sharingClick Here
Dr Latha B ChemistryII BSc A1, B4, B6revision of IR spectroscopy 2020-05-07491122.41122.4Seminar Presentation by Student and assignment through Cisco Webex Watsappp toolsClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterDiscus the department conducted covid quiz2020-05-07291344.841344.84Two sessions online video class by Google duo appClick Here
G V BhaskarMathematics1 year Section - A6Right Line2020-05-071510671067Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0715853853Zoom Video appClick Here
G V BhaskarMathematics3 yearInner Product Spaces2020-05-073513371337Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance-basic concepts of zoology2020-05-07262284.62076.92Google duo discussionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance-basic concepts of zoology2020-05-07131184.61184.6whatsappClick Here
Dr.Vijaya Babu KogantiCommunicative English I B.A CESynonyms and Antonyms2020-05-07551005100CLT THROUGH WORKSHEETClick Here
G V S Pranayani DeviCloud ComputingIII BSC A8REST Integration Revision2020-05-0622627.27627.27Zoom AppClick Here
G Padmini DeviDiet TherapyII B.Sc HomescienceTypes and process of dialysis2020-05-06242291.61666.6Remedial class by whatsappClick Here
Dr S L B SANKARA SARMASanskritII yearస్వయం ప్రవర్తన2020-05-0611981.8981.8zoom appClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Vibhaavaalu2020-05-06141285.711285.71Lesson material shared through What's App groupClick Here
G.sita Electronics 1 BSC MECSVi characteristics of diode 2020-05-06302583.332583.33Assignment through WhatsApp Click Here
P Harshitha Statistics I B.Sc.Mathematical Expectations 2020-05-063915491549Zoom application Click Here
G.sita Electronics 3 BSC MECS (CIUSTER)Instrumentation of measurement systems 2020-05-0611327.27327.27WhatsApp screen sharing Click Here
M.IndirammaEnglishI.BScVerb forms2020-05-062511441144Zoom appClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)MOSFET2020-05-0630413413Webex meet screen sharingClick Here
M.IndirammaEnglishII BAParagraph writing 2020-05-06282382.142382.14WebEx meetClick Here
Dr.Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Plant physiology and metabolism-plant water relations-Transpiration2020-05-062211501150Lectuere method through Zoom AppClick Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)Brute force attack and Encryption2020-05-0622418.18418.18Hangouts video call and whatsapp group chat for assignmentsClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Vemana thaatveeka bhaavalu 2020-05-0617529529Class through zoom appClick Here
Dr. Vijaya Babu KogantiCommunicative EnglishI B.A CESynonyms ans Antonyms2020-05-06441004100Worksheet through CLT TELECONFERENCE Click Here
Dr.G.Swarna LathaTelugu3rd BASHTStructure of modern Telugu, Purusha Bodhaka Pratyayalu2020-05-06141410014100Material given through Whats AppClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterWater and soil characteristics of culture ponds2020-05-06291034.481034.48Two sessions online video classes by Google duo appClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Viswanadha Satyanarayana garu kaviparichayam2020-05-061817941794shared material through Whatsapp group conducted class on go to meeting appClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-064026652665Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG -Entrance -blood and its components2020-05-06262284.62076.92whatsappClick Here
G V BhaskarMathematics1 year Section - A6Right Line2020-05-061511731173Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0615960960Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance-7-blood and its components2020-05-06131184.61184.6whatsappClick Here
Dr.B.D.J.SatyalathaZoology C1, B2& B4Ecology and nutrient cycles2020-05-06625283.565283.56WhatsApp Ppt sharedClick Here
Dr.B.D.J.SatyalathaZoology C2Nervous system 2020-05-06221777.871777.87Video lesson shared through WhatsApp group Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Different types of molecular vibrations in poly atomic molecules2020-05-064910201020Cisco webex meet for revising and watsapp for submitting assignmentClick Here
MADHU LATHA PCHEMISTRY1 B.Scchemical bonding2020-05-06331957.581957.58online video call Click Here
K.VenugopalaraoCommerceII Law terminology quiz2020-05-06302583.332583.33Quiz program conducted in WhatsAppClick Here
K.VenugopalaraoCommerceI Financial accounting Depreciation2020-05-06302583.332583.33Lecture material send through WhatsApp groupClick Here
Dr.K.Anita KumariTraining and HRDIII B.Sc Home scienceTraining methods2020-05-062015951595Remedial classes through watsappClick Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceFats and oils2020-05-063020902090Remedial classes through watsapp groupClick Here
DorkaBiochemistryIII BSc BiochemX-ray Crystallography2020-05-051414100964Assignment through Google classroomClick Here
DorkaBiochemistryI BSc BiochemPDH, LDH2020-05-052212581045Assignment through Google ClassroomClick Here
Dr.Guntupalli GowriTeluguII B.A(S.H.T)Unnava Lakshmi Narayana Panthulu Garu2020-05-051817941794shared material in whatsapp groupClick Here
SHAIK JUBEDAPHYSICSII BSc mpc and mpcsOptics translation and refraction matrix2020-05-05791822.781822.78Jitsi meet app Click Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Arthopakshepakaalu2020-05-05141410014100Lesson material shared through What's app groupClick Here
G.sita Electronics 1 BSC MECSDiodes 2020-05-05302583.332583.33Shared material through WhatsApp group Click Here
P Harshitha Statistics I B.Sc.Mathematical Expectations 2020-05-053914401440Zoom application Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)MOSFET2020-05-0530517617Webex meet screen sharingClick Here
D.Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceRead and write the following definitions 1.Define Ergonomics 2. Work triangle 3.Harmony 4.Rhythm 5.Prospect 6.House 5.Bonsai 6.R2020-05-05242291.61875Remedial class by whatsappClick Here
M.IndirammaEnglishI.BScRemedial class2020-05-052513521352Zoom appClick Here
M.IndirammaEnglishII BACSS2020-05-05282071.432071.43WebEx meetClick Here
Dr S L B SANKARA SARMASanskritI year B. Com. II Semester Krushiphalam2020-05-0510770770Zoom appClick Here
Dr Chilaka AnithaTelugu1 B.A (S.H.T)Vemana kavitha reethulu2020-05-0517424424Zoom appClick Here
Dr.G.Padmini DeviFamily meal managementI B.Sc HomescienceNutritional composition of breast milk including colostrum2020-05-05302066.61550Remedial class by whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance-6-endocrine system2020-05-05262284.61869.23questionare through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance-6-endocrine system2020-05-05131184.61184.6video lesson and question paper shared through whatsappClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-054029732973Zoom Video appClick Here
G V BhaskarMathematics1 year Section - A6The Plane2020-05-051512801280Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0515883883Zoom Video appClick Here
G V BhaskarMathematics3 yearBasis and Dimension2020-05-053511311131Zoom Video appClick Here
K.VenugopalaraoCommerceI Consignment accounting2020-05-05302066.672066.67 Explanation through WhatsApp audio record and material send to studentsClick Here
K.VenugopalaraoCommerceII Business Law2020-05-05302583.332583.33Explanation through WhatsApp audio record and material send to students through WhatsApp groupClick Here
Dr.Ch.Bhaskara RaoBotanyII BSc,BZC (TM)Plant physiology and metabolism-plant water relations2020-05-0522940.9940.9Lecturer method through whats appClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterManagement of hatcheries2020-05-05291241.381241.38Online video class by Google duo appClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterManagement of hatcheries2020-05-05291241.381241.38Online video class by Google duo appClick Here
K.VenugopalaraoCommerceI Bills of exchange2020-05-05302583.332583.33Explanation through WhatsAppClick Here
K.VenugopalaraoCommerceII Kinds of contracts2020-05-05302066.672066.67Explanation through WhatsApp groupClick Here
MADHU LATHA PCHEMISTRY1 B.Scchemical bonding2020-05-05331339.391339.39Whatsapp video chatClick Here
Naga Prasanna. MZoology I yr M.Sc Zoology Agorose gel electrophoresis and PAGE2020-05-05252510025100Video animations and video lectures through WhatsApp Click Here
Dr. Vijaya Babu KogantiCommunicative English P II IB.AReading and Writing 2020-05-05551005100Google Classroom, TeleconferenceClick Here
PRSANTHI DANIE .SPHYSICS1 B.Sc M.Pc and MpcsPrinciple of superposition of waves 2020-05-05701521.431521.43Video Lesson Through WebEx meetClick Here
Dr.K.Anita KumariTie & dyeIII B.Sc Home scienceStages of dyeing2020-05-052015951595Remedial classes through watsapp groupClick Here
Prasanthi DainePhysics 1 BSC (MPC AND MPCS)Combination of two mutually perpendicular S.H.V's in ratio 2:12020-05-04701622.81622.8Webex meet Click Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Dhwani Swarupam2020-05-04141410014100Lesson material shared through What's app groupClick Here
Dr.Guntupalli GowriteluguII B.A(S.H.T)kandukuri veeresilingam panthulu2020-05-041817941794material shared through whatsappClick Here
M PADMAJAPolitical ScienceI BARevision of Judicial Review2020-05-04211152.381152.38Doubts clarification through whatsappClick Here
G.sita Electronics 1 BSC MECSCommon emitter configuration 2020-05-043026.6726.67Webex meet Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)MOSFET2020-05-043027902790Assignment through whatsapp- Click Here
Dr.G.Swarna LathaTelugu3rd BASHTArdhabodhaka Pratyayalu2020-05-04141410014100Material through Whats appClick Here
Ramaraju EZoology III B.SC-Aquaculture clusterAquarium preparation and setting 2020-05-04291448.281448.28Material provided by whatsapClick Here
M.IndirammaEnglishII BACSS2020-05-04282071.431967.86Webex meetClick Here
M.IndirammaEnglishII BACSS2020-05-04282071.431967.86Webex meetClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-044030753075Zoom Video appClick Here
G V BhaskarMathematics1 year Section - A6Right Line2020-05-041512801280Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0415853853Zoom Video appClick Here
G V BhaskarMathematics3 yearBasis and Dimension2020-05-043515431543Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CPG-Entrance-digestive system practice paper2020-05-04262284.62076.92question through whatsappClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumPG-Entrance practice paper-digestive system2020-05-04131184.61184.6video lesson and questionare through wnatsappClick Here
Dr.K.SucharitaMicrobiologyI BScTest conducted and doubt clarifications2020-05-045430553055Zoom WhatsappClick Here
Dr.K.Anita KumariGrowth and development during life spanI B.Sc Home ScienceReflexes2020-05-043020902090Remedial classes through watsapp groupClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceClinical methods2020-05-042220982098Remedial classes through watsapp groupClick Here
Dr.G.Padmini DeviApparel and MerchandisingIII B.Sc HomescienceTrends in retailing, sales promotion technique2020-05-0420201001470Remedial class by whatsappClick Here
Naga Prasanna. MZoology I yr M.Sc Zoology Genomics2020-05-04252510025100Shared video lessons and material through WhatsApp Click Here
Dr Latha B ChemistryII BSc A1, B4, B6Different regions in EMR and finger print region in IR2020-05-04491530.61530.6Cisco webEx Virtual meetingClick Here
Dr Latha B ChemistryII BSc A1, B4, B6concepts of Chromophore Auxochrome and Effect of Conjugation2020-05-0449612.2612.2Cisco Webex virtual meetingClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceClinical methods2020-05-042215851585Remedial classes through watsapp groupClick Here
Prasanthi DainePhysics 1 BSC (MPC AND MPCS)Combination of two mutually perpendicular S.H.V's of equal frequencies 2020-05-03701622.81622.8Webex meet Click Here
SHAIK JUBEDAPHYSICSII BSc mpc and mpcsOPTICS NODAL PLANES2020-05-03792126.582126.58Jitsi meet app Click Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - kaavya Bhedaalu(2)2020-05-03141410014100Shared material through What's app groupClick Here
P Harshitha Statistics I B.Sc.Theorems on Expectations 2020-05-033917441744 Explanation of theorems Zoom application Click Here
Dr.Guntupalli GowriteluguII B.A(S.H.T)Navala lakshanalu2020-05-031817941794shared material through whatsappClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-034026652665Zoom Video appClick Here
G V BhaskarMathematics1 year Section - A6Right Line2020-05-031511731173Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0315853853Zoom Video appClick Here
G V BhaskarMathematics3 yearBasis and Dimension2020-05-033511311131Zoom Video appClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Types of Electronic transitions in UVVis spectroscopy2020-05-03491122.451122.45WebEx and WatsappClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - kaavya Bhedaalu2020-05-02141410014100Lesson material shared through What's app groupClick Here
Dr.Guntupalli GowriteluguII B.A FOURTH SEMNavala upodgaatham2020-05-02181810018100lecture method through whatsappClick Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)Skill-oriented class for jobs2020-05-0222418.18418.18Cisco Webex meeting.Click Here
Ramaraju EZoology III B.SC-Aquaculture clusterQuiz covid192020-05-02291758.621758.62Two sessions online video class by Google duo appClick Here
M venkataramanacommerceIII bcommarginal costing2020-05-02302066.672066.67whatsup group video callClick Here
k venugopala raocommerceI bcombills of exchange2020-05-02302066.672066.67material issue whats up groupClick Here
k venugopala raocommerceIIBcomcontingent of contract2020-05-02302066.672066.67material issue whats up groupClick Here
MADHU LATHA PCHEMISTRY1 B.Scstereo Chemistry - Gen Chem2020-05-02332369.72163.64Interaction Click Here
PRSANTHI DANIE .SPHYSICS1 B.Sc M.Pc and MpcsCompound Pendulum Torsional Pendulum2020-05-02702028.572028.57InteractionClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Autoimmunity2020-05-02262284.62076.92Discussion through whatsapp after sharing pptClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.C,Telugu MediumImmunology-Autoimmunity2020-05-02131184.61184.6discussion through whatsappClick Here
Naga Prasanna. MZoology III yr Aquaculture clusterPrinciples of preservation 2020-05-0229310.34310.34Through WhatsApp Click Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-024025632563Zoom Video appClick Here
G V BhaskarMathematics1 year Section A 6Right Line2020-05-021512801280Zoom Video appClick Here
G V BhaskarMathematics3 yearVector Spaces2020-05-023516461646Zoom Video appClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Types of spectroscopy2020-05-02491530.61530.6Cisco webex for conducting class and Watsapp for assignment submissionClick Here
Ch.NagamalleswariEconomicsIII BA HEP clusterRythubazars2020-05-021512801280Explain the topic through whatsapp video callClick Here
N Rajya LakshmiComputer ScienceIII BComTrade Cycle2020-05-022615571557WhatsApp and Jitsi Meet AppClick Here
N Rajya LakshmiComputer ScienceII BscExplain Types of Data Structures2020-05-023030100100100Whats AppClick Here
N Rajya LakshmiComputer ScienceIII Bsc ClusterDate and Time functions in PHP2020-05-0211870870WhatsAppClick Here
B.Swetha Rani BaiFood ScienceIII B.Sc Home scienceBiochemical ranges2020-05-022015951595Remedial classes through watsapp groupClick Here
Dr.G.Padmini DeviDiet therapyII B.Sc HomescienceRead and write acute and chronic kidney failure.2020-05-022422911875Remedial class by whatsappClick Here
Dr.G.Padmini DeviFamily meal managementI B.Sc HomescienceRead and Write down the physiological changes and problems during pregnancy.2020-05-02302066.61550Remedial class by whatsapp Click Here
Naga Prasanna. MZoology III yr Aquaculture clusterPrinciples of preservation 2020-05-0229310.34310.34Assignment through whatsappClick Here
DorkaBiochemistryI BSc BiochemEnzymes used in Diagnosis2020-05-0122221001254Assignment through Google ClassroomClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Rasa Samkhya2020-05-01141410014100Lesson material shared through What's app groupClick Here
Dr S L B SANKARA SARMASanskritI year II Semester Vasishtasrama gamanam2020-05-0129269026100Zoom appClick Here
M PADMAJAPolitical ScienceI BAJudicial Review2020-05-01302583.332583.33Study material given through whatsapp from Google and YouTube linksClick Here
M PADMAJAPolitical ScienceIII BAEnvironmental Pollution2020-05-01141071.431071.43Study material given through whatsappClick Here
Shaik jubeda Physics II BSc mpc and mpcsOptics location of unit planes2020-05-01792126.582126.58Jitsi meet app Click Here
P Harshitha Statistics I B.Sc.Theorems on Expectations 2020-05-013917441744Zoom application Click Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC)MOSFET2020-05-0137719719Webex meet screen sharingClick Here
Ramaraju EzoologyIII BSc Aquaculture clusterculture ponds2020-05-01291862.81862.8two sessions conduct the online video class by google duo appClick Here
DorkaBiochemistryI & III BSc BiochemAwareness on COVID2020-05-01838310083100Google classroom, Google forms, Whats appClick Here
M venkataramanacommerceIIBcomagreement2020-05-01302066.672066.67material issued whatsup groupClick Here
M.IndirammaEnglishI.BScCSS2020-05-012515601560Zoom appClick Here
M venkataramanacommerceIIBcomincome tax2020-05-01302066.672066.67material issue whats up groupClick Here
M.IndirammaEnglishII BACSS2020-05-01282810028100WebEx meetClick Here
k venugopala raocommerceIIBcomconditions and warreties2020-05-01302066.672066.67material issue whats up groupClick Here
NAGA PRASANNA MEDAZoologyIII AQUACULTURE CLUSTERtransport and storage of fresh fish2020-05-0129413.79413.79Remedial class through jitsi amd whats appClick Here
k venugopala raocommerceI bcomjoint venture2020-05-01302066.672066.67material issue whats up groupClick Here
M venkataramanacommerceIII bcomcomparative statement2020-05-01302066.672066.67whatsup video callClick Here
Dr.K.SucharitaMicrobiologyI BScShort answere assignment and properties of enzymes2020-05-015434633463Screencastify and googleclass room, whatsappClick Here
S.Venkateswara RaoPhysicsIII B.Sc Physics ClusterOPTICAL FIBER2020-05-0114139313100WHATS UP CALLClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Instrumentation and working principle of Double beam spectrophotometer2020-05-01491326.51326.5Virtual presentation through Cisco WebexClick Here
N.DivyasriCommerceI computersEnterprise resource planning life cycle2020-05-01302066.671756.67Explanation through zoom appClick Here
N.DivyasriCommerceIII GeneralMarketing of financial services Differences between products and services2020-05-01302583.32583.3Explanation through zoom appClick Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)Salesforce Marketing and Sales-Error Checking2020-05-0122418.18418.18Google Hangouts and Whatsapp group chatClick Here
R Bhaskara RaoChemistryIII B.Sc. (M.Z.C)Cyclo Alkanes (for M.Sc. Chemistry Entrance Exam)2020-05-012412501250Duo AppClick Here
R Bhaskara RaoChemistryIII B.Sc. (M.Z.C)Complex compounds2020-05-0124833.33833.33Duo AppClick Here
D.KrishnapriyaGeneral psychologyIII B.Sc HomescienceTypes of intelligence2020-05-01201260735Remedial class by whatsappClick Here
D.KrishnapriyaHousing and interior decorationII B.Sc HomesciencePrinciples for table setting2020-05-01241562.51041.6Remedial class by whatsappClick Here
D Naga ChandrikaPsychologyII B.A(P.E.P)aggression2020-05-0114857857online test through whats appClick Here
D UmaBitanyIII yr Botany Transgenic plants2020-05-019778778Zoom cloud meetingClick Here
G V BhaskarMathematics1 year Section - A3The Sphere2020-05-014026652665Zoom Video appClick Here
G V BhaskarMathematics1 year Section A 6Right Line2020-05-011511731173Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-05-0115747747Zoom Video appClick Here
G V BhaskarMathematics3 yearVector Spaces2020-05-013516461646Zoom Video appClick Here
Dr.Guntupalli GowriteluguII B.A FOURTH SEMRaayeprolu Subbarao2020-05-01181810018100lecture method through whatsappClick Here
MADHU LATHA PCHEMISTRY1 B.Scstereo Chemistry - Gen Chem2020-05-01331957.581854.55InteractionClick Here
PRSANTHI DANIE .SPHYSICS1 B.Sc M.Pc and MpcsSimple Harmonic Motion - Differencial Equation2020-05-01702535.712535.71InteractionClick Here
Dr. Vijaya Babu Koganti Communicative English PIII B.A C.EReading and Writing2020-05-015510055Google Class room and TeleconferenceClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Rasa Raajamu2020-04-30141410014100Lesson material shared through what's app groupClick Here
N Rajya LakshmiComputer ScienceIII Bsc Clusterphp control statements2020-04-3011218218whatsAppClick Here
N Rajya LakshmiComputer ScienceIII BCome-commerce advantages2020-04-302615571557whatsAppClick Here
Dr N MANJULA BHARATHIPhysicsIII B.Sc.(MPC)MOSFET2020-04-3037719719Webex meet screen sharingClick Here
Ramaraju EzoologyIII BSc Aquaculture clustermanagement of carp culture2020-04-30291241.381241.38online video class by google duo app-two sessionsClick Here
P Harshitha Statistics I B.Sc.Mathematical Expectations2020-04-303919491949Zoom application Click Here
N.DivyasriCommerceI GeneralBusiness environment2020-04-30302066.672066.67Explanation through WhatsApp and material send to students through WhatsApp groupClick Here
M.IndirammaEnglishI.BScRemedial class2020-04-302511441144Zoom appClick Here
M.IndirammaEnglishII BACSS2020-04-30281864.291864.29WebEx meetClick Here
Dr. prasanna JosphenEconomicsII B.A(H.E.P,C.E,P.E.P)Inflation2020-04-305220382038video lectureClick Here
k.venugopalaraoCommerceFirst year bcomDepreciation2020-04-303020662066Material issued Whats up groupClick Here
k.venugopalaraoCommerceSecond year B.comFree content2020-04-303020662066Material issued whats up groupClick Here
M.venkataramanaCommerceFinal year B.comCommon size statement2020-04-303020662066Whats up group messageClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Monoclonal antibodies-PG-entrance model exam2020-04-30262180.71869.23questionare through whatsappClick Here
Dr.N.AnkammaZoologyM.Sc 11 yearMonoclonal antibodies2020-04-301716941694video lesson presentation shared through whatsappClick Here
G V BhaskarMathematics1 year Section - A3The Cylinder2020-04-304035883588Zoom Video appClick Here
Dr. Vijaya Babu KogantiCommunicative English PII IB.A CEStress identification 2020-04-30441004100Worksheet through CLT- TeleconferenceClick Here
D.Krishna PriyaResource ManagementIII B.Sc Homesciencewrite about tools of time management2020-04-3020201001470Remedial class by whatsapp groupClick Here
G V BhaskarMathematics1 year Section A 6Right Line2020-04-3015960960Zoom Video appClick Here
G V BhaskarMathematics3 yearVector Spaces2020-04-303518511851Zoom Video appClick Here
Dr. B.D.J.SATYA LATHAZOOLOGYII B.Sc. C1 B2 N B4PHYSIOLOGY2020-04-30625283.875283.87Through whats app group MCQs paper is shared. Previous question paper answers were shared in whats app group and collected answeClick Here
Dr. B.D.J.SATYA LATHAZOOLOGYII B.Sc. C2BIO-GEP-CYCLES2020-04-3022528.23528.23ZOOMClick Here
NAGA PRASANNA MEDAZoologyIII AQUACULTURE CLUSTERRIGOR MORTIS AND SPOILAGE2020-04-302927292Remedial class through jitsi appClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Beer lamberts law2020-04-30491224.51224.5Jitsi meetClick Here
D Naga ChandrikaPsychologyII B.A(P.E.P)prejudice2020-04-3014640640online test through whats appClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKodavatiganti Kutumba Rao2020-04-301817941717Online class, study material circulated through WhatsApp Here
Dr.Ch.Bhaskara RaoBotany3rd BSC Botany Cluster paperIEthnobotany and medicinal Botany, plants used by tribal populations2020-04-302510401010Lecturer method through Whts appClick Here
N Rajya LakshmiComputer ScienceIII BComPHP Operators and Data Types, E-Commerce Advantages2020-04-292610381038WhatsApp and Jitsimeet AppClick Here
P Harshitha Statistics I B.Sc.Mathematical Expectations2020-04-293919491949Zoom application Click Here
prasanna EconomicsI B.Akeynesian2020-04-298450450video Click Here
A.SravaniCommerceII B.Com(Banking)Life Insurance Company2020-04-293015501550video lectureClick Here
Dr.G.Padmini DeviDiet therapyII B.Sc HomescienceWrite about Glomerulo nephritis and nephrosis2020-04-29242291.61770.8Remedial class by whatsapp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKodavatiganti Kutumba Rao2020-04-291817941717Online class, study material circulated through WhatsApp Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - kaavya prayojanaalu2020-04-29141410014100Lesson material shared through what's app groupClick Here
M PADMAJAPolitical ScienceI BAPowers and functions of the Judiciary2020-04-2921838.09838.09Conference call and whattsapp Click Here
M PADMAJAPolitical ScienceIII BATerrorism2020-04-2914642.85642.85Material given through whatsappClick Here
Shaik jubeda Physics II BSc mpc and mpcsOptics matrix methods system matrix 2020-04-29791620.251620.25Jitsi app Click Here
k.venugopalaraoCommerceFirst year bcomConsignment2020-04-293020662066Material issued whats up groupClick Here
k.venugopalaraoCommerceSecond year B.comCapacity to contract2020-04-293020662066Material issued whats up groupClick Here
M.venkataramanaCommerceFinal year B.comCommon size statement2020-04-293020662066Whats up group video callClick Here
M.venkataramanaCommerceSecond year B.comIncome from House property2020-04-293020662066Whats up group video callClick Here
M.venkataramanaCommerceSecond year B.comFunction of RBI2020-04-293020662066Whats up group video callClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)FET2020-04-2930827927Webex meet screen sharingClick Here
S.Venkateswara RaoPhysicsIII B.Sc Physics ClusterAdvantages and Applications of optic fiber communication2020-04-29441004100whats up messagesClick Here
N.DivyasriCommerceIII GeneralTypes of Audit2020-04-293025832066.67Explanation through zoom appClick Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceSugars2020-04-293022922292Remedial classes through watsapp groupClick Here
Dr.Vijaya Babu KogantiCommunicative English PIICE I B.AStress identification2020-04-29551005100Worksheet CLT TeleconferenceClick Here
Ramaraju EzoologyIII BSc Aquaculture clusteraquafarms2020-04-29291448.281448.28online video class by google duo appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Antigen antibody interactions2020-04-29262180.71661.53Discussion method through whatsappClick Here
G V BhaskarMathematics1 yearThe Cylinder2020-04-294034853485Zoom Video appClick Here
G V BhaskarMathematics2 yearDifferentiation2020-04-298338338Zoom Video appClick Here
G V BhaskarMathematics3 yearVector Spaces2020-04-293522632263Zoom Video appClick Here
M.IndirammaEnglishII BACSS2020-04-29282810028100WebEx meetClick Here
M.IndirammaEnglishII BACSS2020-04-29282810028100WebEx meetClick Here
N Rajya LakshmiComputer ScienceIII Bsc ClusterPHP Operators and control Statements2020-04-2911436436Whatsapp GroupClick Here
D Naga ChandrikaPsychologyII B.A(P.E.P)prejudice2020-04-2814964964remedial classes through whats appClick Here
D Naga ChandrikaPsychologyI B.A(P.E.P)learning2020-04-282010501050remedial class through whats appClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKodavatiganti Kutumba Rao2020-04-281817941717Online class, study material circulated through WhatsApp Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Kaavya hethuvulu2020-04-28141410014100Lesson material shared through What's app groupClick Here
M.venkataramanaCommerceFinal year B.comManagement accounting and financial accounting2020-04-283020662066Whats up video call and pdfClick Here
M.venkataramanaCommerceSecond year B.comResidential status2020-04-283020662066What's up video call and pdfClick Here
Dr N MANJULA BHARATHIPhysicsIII B.Sc.(MPCs)FET2020-04-2830930930Webex meet screen sharingClick Here
Shaik JubedaPhysicsII BSc mpc and mpcsFraunhoffer diffraction2020-04-28791316.413100Screen sharing through Jitsi meet appClick Here
Ramaraju EzoologyIII BSc Aquaculture clusteraquaculture basics and types2020-04-28291032.81032.8on line video class by google duo appClick Here
Dr S L B SANKARA SARMASanskritI year II Semester Krushiphalam2020-04-28212110021100Zoom appClick Here
Mekala.IndirammaEnglishI.BSc-A6,A8Tenses Exercise2020-04-2825624624Zoom appClick Here
N.DivyasriCommerceIII GeneralIntroduction of Auditing2020-04-28604066.673151Explanation through online Zoom app with pdfClick Here
G V BhaskarMathematics1 yearThe Cylinder2020-04-284029732973Zoom Video appClick Here
G V BhaskarMathematics3 yearVector Spaces2020-04-283524692469Zoom Video appClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Transport number and its determination by Hittorf's method 2020-04-28491326.51326.5Jitsi meetClick Here
Dr.B.D.J.SatyalathaZoology C1, B2& B4Embryology 2020-04-28625283.875283.87WhatsApp group Exam conducted Click Here
Dr.B.D.J.SatyalathaZoology C2Respiratory and circulatory systems 2020-04-2822627.2627.2ZoomClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Overview of the immune system-PG Entrance practice paper2020-04-28262180.71869.23Questionare methodClick Here
D.Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceRead and write about significance of colour in interior decoration.Discuss any five colour harmonies2020-04-28242291.61562.5Remedial class by whatsappClick Here
Dr.G.Padmini DeviFamily Meal ManagementI B.Sc HomescienceWrite about nutritional requirements and eatung problems of adolescents2020-04-28302066.61550Remedial class by whatsappClick Here
NAGA PRASANNA MEDAZoologyI M.Sc ZoologyTools and Techniques in Biology2020-04-28252510025100sHARED YOU TUBE VIDEO LINKS HROUGH WHATS APP Click Here
Dr. M. Hanumanth rajuZoology MSC final yearVitamin deficiency diseases in fish and fish immunoglobulins 2020-04-2817171001717WhatsApp YouTube links shared Click Here
Dr.B.D.J.SatyalathaZoology MSC final yearFish immunoglobulins2020-04-28171710017100WhatsApp YouTube links shared Click Here
k.venugopalaraoCommerceFirst year bcomJoint venture2020-04-283020662066Material issued whats up groupClick Here
k.venugopalaraoCommerceSecond year B.comRemedies for breach of contract2020-04-283020662066Material issued whats up groupClick Here
D Vijaya SreeBiochemistryII B4, B6Denovo synthesis of purines2020-04-2815533533Remedial class by whatsapp groupClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Electro Chemistry Condoctometric titrations2020-04-2849714.3714.3Google hangoutsClick Here
G V S Pranayani DeviCloud computingIII BSC cloud computingintegration2020-04-27221254.51254.5Google Hangouts Video CallClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKodavatiganti Kutumba Rao2020-04-271817941717Online class, study material circulated through WhatsApp Here
Ch.NagamalleswariEconomicsIII BA HEP clusterContract farming2020-04-271512801280Explained the topic through whatsapp Click Here
Sk.HaseenaEconomicsIII BA FEKisa Credit Card Scheme2020-04-2710880880Through the whatsapp video callClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Dasavidha rupakaalu2020-04-27141410014100Lesson material shared through what's app group Click Here
M PadmajaPolitical ScienceI BAWrits2020-04-2721628.576100Doubts clarification through whatsapp and given notes through google and YouTube linksClick Here
M PADMAJAPolitical ScienceIII BAWorld Trade organization2020-04-2714428.57428.57Doubts clarification through whatsapp and given notes from google and YouTube links through whatsappClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPCs)FET2020-04-2730930723Webex meet Click Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home scienceDiet survey2020-04-272219961585Remedial classes through watsapp groupClick Here
Dr.K.SucharitaMicrobiologyI BScQuiz Topic revision Nutritional requirements of micro organisms and uptake of nutrients2020-04-27543766.83666.8Google classroom and whatsapp Click Here
Ramaraju EZoology III B.SC-C1 CLUSTERCluster paper three field record2020-04-2712650650Online video classClick Here
M.IndirammaEnglishI.BSc-A6,A8Remedial class--Prosd2020-04-2725936624Zoom meetingClick Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)Configuration files and Ngrok2020-04-272211501150Google hangouts and Whatsapp Group ChatClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Debye Huckel Onsagar's theory for strong electrolytes2020-04-27491326.51326.5Jitsi appClick Here
Dr.K.Anita KumariGrowth and development during life spanI B.Sc Home SciencePreschool2020-04-273025952595Remedial classes through watsapp group Click Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-1 B2 B4Digestive system 2020-04-27625286.165286.16PowerPoint presentation sent through WhatsApp group Click Here
Dr.B.D.J.SatyalathaZoology MSCLymphoid organs of fish2020-04-27262610026100WhatsApp Material shared Click Here
Dr.B.D.J.SatyalathaZoology C2Digestive system 2020-04-2724416.6416.6ZoomClick Here
Dr.B.D.J.SatyalathaZoology MSCFish pathology 2020-04-27262610026100Material shared through WhatsApp groupClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-272016801680Zoom Video appClick Here
G V BhaskarMathematics3 yearVector Spaces2020-04-273528802880Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Overview of the immune system2020-04-27262180.71453.8Discussion method through video callClick Here
k.venugopalaraoCommerceFirst year bcomConsignment2020-04-273015501240Whats up messageClick Here
k.venugopalaraoCommerceSecond year B.comSale and agreement to sell2020-04-273015501240Whats up messageClick Here
NAGA PRASANNA MEDAZoologyI M.Sc ZoologyTools and Techniques in Biology2020-04-2725251002525Youtube links on different types of chromatography and spectrophotometer and material was shared through Whats app group Click Here
Dr.G.Padmini DeviApparel and MerchandisingIII Bmsc HomescienceRead and write about classification of Retailers2020-04-2720201001470Remedial class by whatsappClick Here
Ch.NagamalleswariEconomicsII BA FEKellyindex numbers2020-04-2610880880Through the whatsapp video call Click Here
Ch.NagamalleswariEconomicsIII BA HEPOrganic farming 2020-04-264737783778Through the whatsapp Click Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Lalitha kalallo Kavithva sthaanam2020-04-26141410014100Lesson material shared through what's app groupClick Here
Shaik jubedaPhysicsII BSc(MPC&mpcs)Optics Diffraction at straight edge2020-04-26791620.2516100JITSI MEET APPClick Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)Web servers and Database Servers 2020-04-26221672.721672.72Google Hangouts Video Call for explaining concepts and Whatsapp Group chat for assignmentsClick Here
Dr.B.D.J.SatyalathaZoology C1, B2& B4Embryology 2020-04-26585589.665589.66WhatsApp group Revision test conducted Click Here
Dr.B.D.J.SatyalathaZoology C2Embryology 2020-04-26221881.561881.56WhatsApp group Revision test conducted Click Here
G V BhaskarMathematics1 yearThe Cone2020-04-2615853853Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-04-268338338Zoom Video appClick Here
G V BhaskarMathematics3 yearMatrix2020-04-263022732273Zoom Video appClick Here
Dr Latha B ChemistryII BSc A1, B4, B6Electro Chemistry: Ostwald dilution law 2020-04-26491530.61530.6Jitsi meeting for conference and assignment submission through Watsapp Click Here
N.DivyasriCommerceI computersEnterprise resource planning2020-04-26603558.32745Online Quiz program through WhatsApp and material send to students through WhatsApp groupClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Electric and magnetic flux2020-04-267542564256Cisco WebExClick Here
Ch.NagamalleswariEconomicsII BA FEFishers numbers 2020-04-2510990990Through whatsapp video callClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Rasa Nishta2020-04-25141410014100Lesson material shared through what's app groupClick Here
Sk.HaseenaEconomicsIBA PEPClassification of markets 2020-04-2520630630Explained the topic through whatsapp Click Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)User interface design, Styling2020-04-25221045.51045.5Google Hangouts Video Call and Whatsapp chat for assignmentsClick Here
R Bhaskara RaoChemistryIII B.Sc. (M.Z.C)Inductive Effect and its Applications (for MSC Chemistry Entrance Examination)2020-04-25241041.661041.66Using Google Duo AppClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC)FET2020-04-2537924924Screen sharingClick Here
NAGA PRASANNA MEDAZoologyIII MZC & BiZCGLYCOLYSIS2020-04-2525624624Remedial class through jitsi appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-classification and functions of antibodies2020-04-25262284.61557.6Revision test conducted for 2marks questions by sharing question paper through whatsapp group.Click Here
Mekala.IndiraEnglishI.BScRemedial class2020-04-255480480ZoomClick Here
Dr. Vijaya Babu KogantiCommunicative EnglishI B.ASyllabification revision2020-04-25331003100Worksheets through CLT METHOD TELECONFERENCEdClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-251510671067Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-04-258338338Zoom Video appClick Here
G V BhaskarMathematics3 yearMatrix2020-04-253019631963Zoom Video appClick Here
Dr Latha B ChemistryII BSc MPCArrhenius theory for weak electrolytes2020-04-25371232.41232.4Jitsi meet for Video conferenceClick Here
D Vijaya sreeBiochemistryII B4, B6Lecithin metabolism2020-04-2515320320Remedial class by whatsapp groupClick Here
D Vijaya SreeBiochemistryIII B4, B6Bioinformatics Pairwise alignment2020-04-256956956Remedial class by whatsapp groupClick Here
k.venugopalaraoCommerceSecond year B.comValid contract2020-04-255025502040Whats up messages and group messageClick Here
P Harshitha Statistics III B.Sc.Time series analysis 2020-04-2431929929Zoom application Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKodavatiganti Kutumba Rao2020-04-241817941717Online class, study material circulated through WhatsApp Here
Dr.K.Anita KumariGrowth and development during life spanI B.Sc Home ScienceLate childhood2020-04-243020902090Remedial classes through watsapp groupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram - Rasa Swarupam2020-04-24141410014100Lesson material shared through what's app groupClick Here
D Vijaya SreeBiochemistryII B4, B6Beta oxidation2020-04-241510671067Remedial class by whatsapp groupClick Here
Mekala.IndirammaEnglishI.BScOn saying please2020-04-24755556ZoomClick Here
Mekala.IndirammaEnglishI.BScOn saying please2020-04-24755556ZoomClick Here
Naga Prasanna. MZoology III MZC & BiZC Carbohydrate class2020-04-24252828Remedial class through jitsi appClick Here
Deepthi KancharlaComputer ScienceIII B.Sc. (Maths-Cloud-CS)Salesforce Marketing and Sales-Email to case2020-04-24221672.71672.7Google Hangouts Video CallClick Here
Dr. Vijaya Babu KogantiCommunicative EnglishI B.AIntonation III revision2020-04-24331003100CLT TeleconferenceClick Here
Dr. N. Manjula BharathiPhysicsIII B. Sc(MPC)FET2020-04-2437513513RevisionClick Here
Dr Latha B ChemistryII BSc MPCElectrochemistry revision 2020-04-24351131.41131.4Virtual class through WebEx appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CStructure of Antibody2020-04-24262284.61672.7questionare and discussion method through whatsapp after sharing study material on the given topic.Click Here
Dr.B.D.J.SatyalathaZoology II B.Sc C-2Types of eggs2020-04-24261557.351557.35Whatsapp video callClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-241512801280Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-04-248338338Zoom Video appClick Here
G V BhaskarMathematics3 yearLinear Transformations2020-04-243026872687Zoom Video appClick Here
Dr S L B SANKARA SARMASanskritI year II Semester Vyakaranam2020-04-24101010010100Zoom appClick Here
Ch.NagamalleswariEconomicsII BA FEIndex numbers2020-04-2410880880Topic explained through the whatsapp Click Here
Sk.HaseenaEconomicsI BA HEPRicardian rent theory2020-04-244730633063Topic explained through whatsapp Click Here
D.Krishna PriyaGeneral PsychologyIII B.Sc HomescienceNature and tests of intelligence2020-04-2420201001575Remedial class by whatsappClick Here
D.Krishna PriyaHousing and interior decorationII B.Sc HomescienceArt principles2020-04-24242291.671770.83Remedial class by whatsappClick Here
M.venkataramanaCommerceFinal year B.comMarginal costing2020-04-245020401530Metting was done in zoom appClick Here
Dr.K.SucharitaMicrobiologyI BScQuiz Revision of topics in measurement of growth2020-04-24543157.42444.4Google classroom and whatsappClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram- Paschaathya Alamkaarikulu2020-04-23141410014100Lesson material shared through What's app groupClick Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC)Doubts clearance2020-04-23331003100Question and answer along with explanationClick Here
M PadmajaPolitical ScienceI BAParliamentary Government2020-04-2321628.57523.8Doubts clarification through whatsappClick Here
M IndirammaEnglishI BScI'm not that woman2020-04-2375515515Whatsapp groupClick Here
DorkaBiochemistryIII BScAwareness on COVID2020-04-23262610026100 Google Classroom, Whats app, Google formsClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceAnthropometric assessment2020-04-232222981985Remedial classes through watsapp groupClick Here
DorkaBiochemistryIII BSc BiochemBt Cotton2020-04-2316161001275Google classroomClick Here
DorkaBiochemistryIII BSc BiochemAwareness on COVID2020-04-231612751275Google Classroom, Google forms, Whats appClick Here
Dr. B.D.J.SATYA LATHAZOOLOGYII B.Sc. C1GAMETOGENESIS2020-04-2328828.23828.23ZOOMClick Here
Dr. B.D.J.SATYA LATHAZOOLOGYII B.Sc. B2 B4PLACENTA2020-04-232666.266.2ZOOMClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRachayithri Kanaparthi Lakshmamma2020-04-231817941717Online class, study material circulated through WhatsApp Here
Dr Latha B ChemistryII BSc MPCSpectrophotometry Revising Single and double beam spectrophotometry 2020-04-23351542.81028.6Virtual class through jitsi meetClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-2315853853Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-04-238450450Zoom Video appClick Here
G V BhaskarMathematics3 yearLinear Transformations2020-04-232421882188Zoom Video appClick Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-Antigens2020-04-23262284.61881.8Discussion method through Whatsapp and conducted exam on 2 -marks questionsClick Here
Dr. Vijaya Babu KogantiCommunicative English I B.AIntonation2020-04-23331003100Worksheet through CLT - TeleconferenceClick Here
Dr.K.Anita KumariGrowth and development during life spanI B.Sc Home ScienceLate childhood2020-04-233020902090Remedial classes through watsapp groupClick Here
D Vijaya SreeBiochemistryII B4, B6Photophosphorylation2020-04-231510671067Remedial class by whatsapp groupClick Here
R Bhaskara RaoChemistryIII B.Sc. (M.Z.C)M.Sc. Entrance Exam Coaching2020-04-232412501250Using Google Duo appClick Here
D.Krishna PriyaResource ManagementIII B.Sc HomescienceTime demands in stages of family life cycle2020-04-2320201001470Remedial class through whatsappClick Here
A. SravaniCommercell. B. ComBanking account2020-04-235020302030VioClick Here
N Rajya LakshmiComputer ScienceIII Bsc ClusterPHP Operators and control Statements2020-04-2311436436whatsappClick Here
Dr Vijaya Babu KogantiCommunicative English PIII B.AIntonation2020-04-22441004100CLT - Tele ConferenceClick Here
Shaik JubedaPhysicsII BSC MPC & MPCSFresnel half period zones2020-04-228787.5787.5JITSI APPClick Here
Dr Latha B ChemistryII BSc MPCSpectrophotometry Laws of Absorption2020-04-2235822.8822.8Conducted Virtual class through Jitsi meetClick Here
Dr.G.Padmini DeviDiet TherapyII B.Sc Home scienceClassification of theraupetic and hospital diets2020-04-22242291.61777.2Remedial class through whatsappClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-2215960960Zoom Video appClick Here
G V BhaskarMathematics2 yearRiemann Integration2020-04-228338338Zoom Video appClick Here
G V BhaskarMathematics3 yearLinear Transformations2020-04-222415631563Zoom Video appClick Here
Dr.K.Anitha KumariTraining and HRDIII Homescience 1.Explain the role of training 2.what are steps involved in designing and conducting training. Explain in detail2020-04-2220201001680Remedial class through whatsapp groupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram2020-04-22141410014100Lesson material shared through What's app groupClick Here
D Vijaya SreeBiochemistryII BE, B6Glycolysis and Krebs cycke2020-04-221512801280Remedial class by whatsapp group Click Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceFermented and unfermented foods of milk products & milk processing2020-04-222020902090Remedial classes through watsapp groupClick Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceFermented and unfermented foods of milk products & milk processing2020-04-222020902090Remedial classes through watsapp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRachayithri Kanaparthi Lakshmamma2020-04-221817941717Online class, study material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRachayithri Kanaparthi Lakshmamma2020-04-221817941717Online class, study material circulated through WhatsApp Here
Dr.N.AnkammaZoology111B.Sc,B.Z.COrgans of immune system2020-04-22262284.61246.15Discussion through whatsapp and conducted MCQ exam for PG-Entrance.Click Here
Dr. Vijaya Babu KogantiCommunicative EnglishI B.ABrain Storming and Mind Mapping2020-04-21221002100Communicative Language Teaching.Click Here
D Vijaya SreeBiochemistryII B4, B6Glycogen metabolism, HMP shunt2020-04-2115960746Remedial class through Whatsapp groupClick Here
D.Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceArt elements2020-04-21242291.61777.2Remedial class through whatsappClick Here
Dr.G.Padmini DeviFamily meal managementI B.Sc HomescienceNutritional requirements of pregnant and lactating women2020-04-21302066.61680Remedial class through whatsapp groupClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-2115747747Zoom Video appClick Here
G V BhaskarMathematics2 yearSequences2020-04-218338338Zoom Video appClick Here
G V BhaskarMathematics3 yearLinear Transformations2020-04-212415631563Zoom Video appClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram2020-04-21141410014100Lesson material shared through What's app groupClick Here
DorkaBiochemistryI BScAmino acids Part - 12020-04-212613501350Youtube Video lesson prepared by meClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRachayitri Kanaparthi Lakshminarayana2020-04-211817941717Online class, study material circulated through WhatsApp Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CCells of immune system2020-04-21262284.61557.6Discussion through whatsapp and conducted exam for PG entranceClick Here
Dr.K.SucharitaMicrobiologyI BScMicrobial growth 2020-04-215429532953Whatsapp and google classroom Click Here
Dr. Vijaya Babu,KogantiCommunicative EnglishI B.AArticles and Prepositions2020-04-2032672100CLT - TeleconferenceClick Here
D Vijaya SreeBiochemistryIII B4, B6Bioinformatics File formats2020-04-201615931275Remedial class by whatsapp group, screenshots of different file formats of the protein of their interest were sentClick Here
Shaik.JubedaPhysicsII BSC MPC & MPCSMichelson Interferometer2020-04-20881008100JITSI Video AppClick Here
Dr.G.Padmini DeviApparel and HomesciencePlanning process and adding value to supply chain2020-04-2020201001575Remedial class in whatsapp groupClick Here
Dr.K.Anitha KumariGrowth and development during lifespanI Homescience 1.Characteristics of adolescents -Discuss 2.Explain parenting styles and their impact on personality 3.Define puberty and writ2020-04-20302066.661680Remedial class through whatsapp groupClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram2020-04-20141410014100Lesson material shared through What's app groupClick Here
Ch.NagamalleswariEconomicsIII BA HEPRegulated markets2020-04-20104404100Through whatsapp video callClick Here
DorkaBiochemistryIII BScPCR2020-04-2016121007575Google classroomClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemViswanadha Satyanarayana gari kavi parichayam2020-04-201817941717Online class, material circulated through WhatsApp Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceAll definitions of community nutrition2020-04-202215851585Remedial classes through watsapp groupClick Here
Ch.NagamalleswariEconomicsIII BA HEP clusterRegulated markets2020-04-201510661060Explain the topic through whatsapp Click Here
Dr.K.SucharitaMicrobiologyI BScDiscussion about assignment of work and doubt clarifications2020-04-205426482442Zoom app and whatsapp Click Here
Shaik.JubedaPhysicsII BSC MPC & MPCSNewtons Rings2020-04-19551005100JITSI Video AppClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram2020-04-19141410014100Lesson material shared through What's app groupClick Here
D Vijaya SreeBiochemistryIII B4, B6Biological databases2020-04-181613811275Remedial class by whatsapp groupClick Here
G V BhaskarMathematics1 yearThe Cone2020-04-181512801280Zoom Video appClick Here
G V BhaskarMathematics2 yearSequences2020-04-188450450Zoom Video appClick Here
G V BhaskarMathematics3 yearOrthogonality2020-04-182420832083Zoom Video appClick Here
Dr. N. VijayalakshmiTeluguIII B.A (S.H.T)Alankaara saasthram2020-04-18141410014100Lesson material and instructions given through whatsapp groupClick Here
B.Swetha Rani BaiProjectIII B.Sc Home sciencePreparation of objective type questions on nutrition2020-04-182019991999Remedial classes through watsappClick Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceCooking methods2020-04-183020902090Remedial classes through watsapp groupClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home ScienceIodine deficiency disorders2020-04-182215701570Remedial classes through watsapp groupClick Here
G V BhaskarMathematics1 yearThe Sphere2020-04-171513871387Zoom video appClick Here
G V BhaskarMathematics2 yearSequences2020-04-178450450Zoom video appClick Here
G V BhaskarMathematics3 yearOrthogonality2020-04-172421882188Zoom video appClick Here
D Krishna PriyaGeneral PsychologyIII B.Sc HomescienceCharacteristics of a counsellor and counselling process2020-04-1720201001575Remedial class through whatsapp groupClick Here
D krishna PriyaHousing and Interior DecorationII B.Sc Home Science1.Types of furniture 2. Factors to be considered while selection and arranging the furniture2020-04-17242291.61672.7Remedial class through Whats app groupClick Here
Dr.G.Padmini DeviFamily Meal ManagementI B.Sc HomescienceDefinitions 2020-04-17302066.61680Remedial class through whatsapp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemViswanadha Satyanarayana gari kavi parichayam2020-04-171817941717Online class, material circulated through WhatsApp Here
D Krishna PriyaResource ManagementIII B.Sc Home scienceMundal's classes of change2020-04-1620201001575Remedial class through WhatsappClick Here
Dr.K.Anitha KumariGrowth and development during lifespanI B.Sc Homescience 1.Explain cognitive development during adolescence period 2. Discuss social development during adolescence period 3. Writ2020-04-16302066.661575Remedial class through whatsapp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemViswanadha Satyanarayana gari kavi parichayam2020-04-161817941717Online class, material circulated through WhatsApp Here
Dr. N. Manjula BharathiPhysicsIII B.Sc.(MPC), III B.Sc.(mpcs)Virtual lab..AND,OR,NOT gates2020-04-167555735573Google classroomClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home science1.PEM 2.Vitamin-A deficiency 3.Food adulteration2020-04-162220982098Remedial classes through watsapp groupClick Here
Dr.Vijaya Babu KogantiCommunicative EnglishI B.ASentence Corrections2020-04-15326722Communicative Language TeachingClick Here
Dr.G.Padmini DeviDiet TherapyII B.Sc HomescienceAtherosclerosis mechanism and Dietary management2020-04-15242291.61568.1Remedial class through whatsapp groupClick Here
Dr.K.Anitha KumariTraining and HRDIII B.Sc Homescience1. Explain need and outcomes of HRD 2. Write the concept of HRD 3.What are the functions of HRD 4.Explain the goals of HRD2020-04-1520201001680Remedial class through whatsapp groupClick Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceDifferent methods of parboiling & Food additives2020-04-151913751970Remedial classes through watsapp groupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemViswanadha Satyanarayana gari kavi parichayam2020-04-151817941717Online class, material circulated through WhatsApp Here
B.Swetha Rani BaiFood ScienceI B.Sc Home ScienceDifferent methods of parboiling & Food additives,rigor mortis2020-04-153020901585Remedial classes through watsapp groupClick Here
D.Krishna PriyaHousing and Interior DecorationII B.Sc HomescienceTypes of Accessories,Furniture and Furnishings2020-04-14242291.61568.1Remedial class through whatsappClick Here
Dr.G.Padmini DeviFamily Meal ManagementI B.Sc Homescience1.Geriatric nutrition 2.Dietary modifications needed in old age and problems of old age2020-04-14302066.61680Remedial class through whatsapp groupClick Here
Dr.K.Anitha KumariTie and DyeIIIB.Sc Homescience1. Mention the types of fastness tests and write each test procedure in detail2020-04-1420201001575Remedial class through whatsappClick Here
Dr.Koganti Vijaya BabuCommunicative EnglishI yearError Analysis2020-04-1332672100A worksheet was shared in advance and during the whatsapp class, the teacher elicited the answers and discussed the wrong ones wClick Here
Dr.G.Padmini DeviApparel and MerchandisingIII B.Sc HomescienceSupply chain management definition and drivers of supply chain2020-04-1320201001575Remedial class through whatsapp groupClick Here
Dr.K.Anitha KumariGrowth and Development during LifespanI B.Sc Homescience1.Define Identity and explain the process of identity development in adolescence period. 2. Discuss identity crisis among adole2020-04-13302066.61680Remedial class through whatsappgroupClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemUnnava Lakshmi Narayana Panthulu Garu2020-04-131817941717Online class and study material circulated through WhatsApp Here
B.Swetha Rani BaiFood ScienceI B.Sc Home SciencePigments present in fruits and vegetables2020-04-133025952595Remedial classes through watsapp groupClick Here
B.Swetha Rani BaiCommunity NutritionII B.Sc Home scienceRole of national and international organizations promoting health and nutrition2020-04-132220952095Remedial classes through watsapp groupClick Here
B.Vijaya rekhaZoologyM.Sc finalnutritional types of microorganisms2020-04-1225936936google meetClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemUnnava Lakshmi Narayana Panthulu Garu2020-04-101817941717Online class and study material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemUnnava Lakshmi Narayana Panthulu Garu2020-04-091817941717Online class and study material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemUnnava Lakshmi Narayana Panthulu Garu2020-04-081817941717Online class and study material circulated through WhatsApp Here
DorkaBiochemistryI BScAmino acids Part - 22020-04-062613501350Video lecture through You tubeClick Here
G V S Pranayani DeviCloud COmputingIII BSC A8Partner WSDL2020-04-0572232.81732.81Zoom App Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKandukuri Veeresilingam Panthulu2020-04-031817941717Online class, study material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKandukuri Veeresilingam Panthulu2020-04-011817941717Online class, study material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemKandukuri Veeresilingam Panthulu2020-03-291817941717Online class, study material circulated through WhatsAppClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Lakshanalu2020-03-281817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Lakshanalu2020-03-271817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Lakshanalu2020-03-271817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Lakshanalu2020-03-261817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Lakshanalu2020-03-261817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Upodhgatham2020-03-251817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Upodhgatham2020-03-221817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemNavala Upodhgatham2020-03-211817941717Online class, material circulated through WhatsApp Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRayaprolu Subba Rao2020-03-201817941717Online class, material circulated through WhatsAppClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRayaprolu Subba Rao2020-03-191817941717Online class, material circulated through WhatsApp.Click Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRayaprolu Subba Rao2020-03-181817941717Online classes, material circulated through WhatsAppClick Here
Dr. Guntupalli GowriTeluguII BA (S.H.T) IVth SemRayaprolu Subba Rao2020-03-151817941717Online class and material circulated through WhatsAppClick Here
NAGA PRASANNA MEDAZoologyI M.Sc ZoologyTools and Techniques in Biology2020-00-2625251002525Shared ppt and HPLC youtube link through Whats app groupClick Here
Y.NagarathnammaBotanyIII BZC(TM)RNA2019-11-202013651313Lecture methodClick Here
Y.NagarathnammaBotanyIII BZC(TM)RNA2019-11-202013651313Lecture methodClick Here
Dr.Ch.Bhaskara RaoBotany3 rd BSC,BZC -C1 SectionDNA Structure2019-11-20401539.471539.47Lecture method Click Here
M.Kamala KarunachemistryIII B.Scquantum yield of a photochemical reactions2014-08-207021302130zoom appClick Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsAssignment exam2013-09-207767.867.8Webex app and Google Classroom Click Here
SHAIK JUBEDA PHYSICS II BSc mpc and mpcsAssignment exam2013-09-207767.867.8Webex app and Google Classroom Click Here
M.Kamala KarunachemistryIB.Scbond order and bond energies2011-05-20533737lecture method through,webex meetClick Here
M.Kamala KarunachemistryIB.Scbond order and bond energies2011-05-20533737lecture method through,webex meetClick Here
M.Kamala KarunachemistryIB.ScMO THEORY2009-05-2053916916webex meet ,explined thruogh shared documentClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home scienceDietetic principles0202-09-142313601360Zoom web meetingsClick Here
M.Kamala KarunachemistryIII B.Scphoto chemistry0005-08-204527602727zoom appClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Chromosomes 0000-00-002813471347Google meet lecture method with ppt Click Here
Kuchipudi SujathaChemistryII Bsc C2spectroscopy0000-00-0092339939.1Whatsapp video callClick Here
D. Krishna PriyaHomeII bscHousing and interior decoration quiz0000-00-002820712071Google formClick Here
DorkaBiochemistryIII BSc BiochemMolecular Biology0000-00-001815831583Syllabus Circulation & writng by students through Whats app Click Here
DorkaBiochemistryIII BSc BiochemIntroduction to Molecular Biology0000-00-001814781478Molecular Biology Lecture - DiscussionClick Here
Anusha KChemistryIII sem B.ScMetal carbonyls Ferrocene0000-00-004935713571googlemeetClick Here
Anusha KChemistryIII sem B.ScMetal carbonyls 0000-00-004928572857google meetClick Here
DorkaBiochemistryIII BSc BiochemIntroduction to Molecular Biology0000-00-001814781478Lecture Discussion in Google meetClick Here
Anusha KChemistryIII sem B.ScMetal carbonyls 0000-00-004928572857googlemeetClick Here
Anusha KChemistryIII sem B.ScMetal carbonyls 0000-00-004928572857goglemeetClick Here
N. BHAGYA RAJUCommerceIII Bcom (General) Financial services Demat services0000-00-00302583.332583.33Material sent to the students through the whatsapp GroupsClick Here
N. BHAGYA RAJUCommerceIII Bcom (General) Financial services Demat services0000-00-00302583.332583.33Material sent to the students through the whatsapp GroupsClick Here
Dr. g.padmini deviHomescience III B.Sc. H.sctypes of communication0000-00-00231669.571669.57zoomClick Here
Dr. g.padmini deviHomescience III B.Sc. H.sctypes of communication0000-00-00231669.571669.57zoomClick Here
Dr.Gowri GuntupalliTeluguII B.A(S.H.T)Rachayathri Kanaparthi varalakshmi0000-00-001817941794shared material through whatsappClick Here
AsravaniCommerceIII B. Com (com&b@bank) Introduce cost accounting0000-00-005020402040Webex meetClick Here
A. SravaniCommerceIII B. Com (com&b@bank) Cost sheet0000-00-007031403140Webex meetClick Here
Dr.G.Swarna LathaTelugu3rd BASHTStructure of modern Telugu, syntax0000-00-00141410014100Whats app video callClick Here
Dr. R.Prasanna JosphenEconomicsII B.APhilips curve0000-00-003420582058online class through whats appClick Here
Dr. R.Prasanna JosphenEconomicsI B.A(F.E)investment function0000-00-008450450revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsI B.A(F.E)Marginal Efficiency of capital0000-00-008787787revision through whats appClick Here
Dr.Guntupalli GowriTelugu II B.A(S.H.T)Madhuraanthakam Raja ram0000-00-001817941794shared material through whatsappClick Here
Dr. R.Prasanna JosphenEconomicsII B.A(C.E)Philips curve0000-00-008675675revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsIII B.A(F.E)Financial Market in india0000-00-008565565online revision classes through whats appClick Here
Dr. R.Prasanna JosphenEconomicsI B.Com(computers)Micro Economics and Macro Economics0000-00-00606161online revision through whats appClick Here
Dr S L B SANKARA SARMASanskritIII SemesterVyakaranam0000-00-0035351003497Cisco WebexClick Here
Dr.Guntupalli GowriTelugu II B.A(S.H.T)Madhuraanthakam Raja ram0000-00-001817941794shared material through whatsappClick Here
N. BHAGYA RAJUCommerceIII Bcom (Banking &computers) MARKETING Product Branding and it's types0000-00-003027902790Ppts sent to students through the whatsApp groupsClick Here
B.SucharithaChemistryM.SC;2nd yearMethods to determine reaction mechanism of free radicals 0000-00-0013431431lecture method using zoom appClick Here
Devarapalli Uma BotanyIII BSC B5Transgenic Plants0000-00-009777.8777.8 Video lesson / pptClick Here
G.sita Electronics 1 BSC MECSPower supplies 0000-00-0030413.3413.3Webex meet Click Here
G.sita Electronics 3 BSC MECS (CIUSTER)Embedded system 0000-00-0011327.2327.2Webex meet Click Here
G.sita Electronics 1 BSC MECSDiodes 0000-00-0030413.3413.3Webex meet Click Here
G.sita Electronics 1 BSC MECSBipolar junction transistor 0000-00-0030310310Webex meet Click Here
G.sita Electronics 3 BSC MECS (CIUSTER)Instructions of 8085 microprocessor 0000-00-0011327.2327.2WhatsApp Click Here
Dr.N.AnkammaZoology111B.Sc,B.Z.CImmunology-monoclonal antibodies revision and doughts clarification for PG Entrance0000-00-00262284.62079video call through google duoClick Here
Dr. Ch.Bhaskara RaoBotanyIII B.Sc, Botany cluster paperIEthnobotany and medicinalBotany- Gloriosa plant description0000-00-002511441144Lecturer method through Whats appClick Here
Dr.G.Swarna LathaTelugu3rd BASHTStructure of modern Telugu, syntax0000-00-00141410014100Material through Whats appClick Here
Shaik JubedaPhysicsII BSc mpc and mpcsZone plate0000-00-00161610016100JITSI MEET APPClick Here
D krishnapriyaHomescienceIII B.Sc Resource managementManagement process0000-00-00201050945Google classroomClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel deviations0000-00-003823602360Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel deviations0000-00-003823602360Google meet Click Here
Dr Vijaya Babu KogantiEnglishCommunicative English III Unit II Describing People and Places0000-00-00881008100CLT - Elicitation and DiscussionClick Here
Y.NagarathnammaBotanyII Bzc(TM)Prokaryotes0000-00-003515421542ZOOM CLASSClick Here
Y.NagarathnammaBotanyII Bzc(TM)Bryophytes0000-00-003510351035ZOOM CLASSClick Here
Y.NagarathnammaBotanyIII BZC(TM)Genetic material0000-00-0016850850ZOOM CLASSClick Here
Y.NagarathnammaBotanyIII BZC(TM)Taxonomy introduction0000-00-00161062.5850ZOOM CLASSClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel deviations0000-00-003824682465Google meet Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel deviations0000-00-003824652465Google meet Click Here
G.sita Electronics 1 BSC MECSPhoto electric devices0000-00-0030413.33413.33Webex meet Click Here
G.sita Electronics 1 BSC MECSPhoto electric devices0000-00-0030413.33413.33Webex meet Click Here
SravaniCommerceIII B.Com(gen)Brack even analysis0000-00-005030603060revision using whats appClick Here
SravaniCommerceII B.Com(Banking) and II B.Com(gen)Bank Accounts0000-00-007030403040revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsI B.A(F.E)investment multiplier0000-00-008787787revision through whats app Click Here
Dr. R.Prasanna JosphenEconomicsI B.A(F.E)economic growth and development0000-00-008787787revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsII B.A(H.E.P)public finance0000-00-003420592059revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsII B.A(H.E.P)public goods and private goods0000-00-003411321132revision through whats appClick Here
Y.NagarathnammaBotanyIII BZC(TM)Chromosome structure0000-00-002215731573Lecture method with relevant topics pictures sharing with zoom appClick Here
Dr. R.Prasanna JosphenEconomicsII B.A(P.E.P)credit control of RBI0000-00-0011655655revision through whats appClick Here
Y.NagarathnammaBotanyIII BZC(TM)Chromatid 0000-00-002010501050Lecture method through picturesClick Here
Dr. R.Prasanna JosphenEconomicsIII B.A(F.E)Exim policy in inndia0000-00-008675675revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsII B.A(H.E.P)types of budget deficit0000-00-003412351235revision classes through whats appClick Here
Dr. R.Prasanna JosphenEconomicsII B.A(C.E)functions of commercial bank0000-00-00878788revision through whats appClick Here
Dr. R.Prasanna JosphenEconomicsI B.A(F.E)history of five years plan in indian economy0000-00-008788788revision through whats appClick Here
B.SucharithaChemistryM.SC II YearTechniques to determine mechanism of a Chemical Reaction 0000-00-0013646646zoom app screen sharing Lecture methodClick Here
B.SucharithaChemistryM.SC II YearTechniques to determine mechanism of a Chemical Reaction 0000-00-0013646646zoomapp screen sharing----Lecture methodClick Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws0000-00-002811391139Google meet lecture method with ppt Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws0000-00-002811391139Google meet lecture method with ppt Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Mendel laws0000-00-002811391139Google meet lecture method with ppt Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c2Cell biology, viruses 0000-00-002816651665Material shared through WhatsApp group and doubts clarified Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Genetics0000-00-003824772477Google meet lecture method with ppt Click Here
D UmaBotanyI MBCAnamolous Secondary growth0000-00-0025832832Zoom cloud meetingClick Here
KuchipudisujathachemistryII BscD Block Elements0000-00-00351131.41111lecture method have to use zoom appClick Here
B.Swetha Rani Baibakery & confectionaryIII B.Sc Home ScienceFlours0000-00-002315601560zoom web meetingsClick Here
B.Swetha Rani BaiDiet counsellingIII B.Sc Home Scienceneeds of patient 0000-00-002316601660zoom meetings Click Here
Dr.B.D.J.Satya latha ZOOLOGY 2nd yr c1Mendel laws0000-00-003824652465Google meet lecture method with ppt Click Here
