Name of the Faculty | Subject | Class | Topic | Conducted Date | No. of Students Enrolled | No. of Students Attended | % of Students attended | No. of Students attended full session | % of Students attended full session | Methodology adopted | Evidence |
---|---|---|---|---|---|---|---|---|---|---|---|
M.Vijaya Lakshmi | English | MPC n Home science | Earth democracy | 2024-08-20 | 58 | 58 | 100 | 58 | 100 | Whatsapp You Tube Vidieo | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | Plasmalemma | 2023-11-20 | 20 | 12 | 60 | 12 | 60 | Lecture method | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Sex linked inheritance | 2021-12-02 | 40 | 35 | 95 | 35 | 95 | Video lesson shared through WhatsApp | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | DNA Double Helix structure | 2021-11-20 | 20 | 13 | 65 | 13 | 65 | Lecture method with ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Sex linked inheritance | 2021-01-02 | 38 | 25 | 92 | 38 | 92 | Video lesson shared through WhatsApp group | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Sex linked inheritance | 2021-01-02 | 38 | 25 | 92 | 38 | 92 | Video lesson shared through WhatsApp group | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Sex linked inheritance | 2021-01-02 | 38 | 25 | 92 | 38 | 92 | Video lesson shared through WhatsApp group | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Concept behind classification of fishes. | 2020-12-31 | 25 | 4 | 16 | 4 | 16 | Google Meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Sex linked inheritance | 2020-12-30 | 40 | 30 | 90 | 30 | 90 | Video lesson shared through watts app group | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendelian deviations | 2020-12-30 | 30 | 25 | 95 | 25 | 95 | Video lesson shared through WhatsApp group | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Study hour on Classification of fishes. | 2020-12-30 | 25 | 9 | 36 | 7 | 28 | Google Meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Sex linked inheritance | 2020-12-29 | 28 | 26 | 98 | 26 | 98 | Video lesson shared through WhatsApp | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Types of Scales in fishes. | 2020-12-29 | 25 | 10 | 40 | 10 | 40 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Macrophytes / Large aquatic plants. | 2020-12-28 | 25 | 9 | 36 | 8 | 32 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Assessment of performance in Mid-semester exams. | 2020-12-26 | 25 | 8 | 32 | 6 | 24 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Conducted mid exam – Limnology. | 2020-12-23 | 25 | 13 | 52 | 13 | 52 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Review of Limnology for Mid semester exam. | 2020-12-22 | 25 | 15 | 60 | 6 | 24 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Mid semester Examination – Ichthyology. | 2020-12-21 | 25 | 14 | 56 | 14 | 56 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Study hour and preparation for Ichthyology. | 2020-12-20 | 25 | 11 | 44 | 11 | 44 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Review of Dissolved Oxygen and Nitrogen cycle for mid exams. | 2020-12-19 | 25 | 10 | 40 | 6 | 36 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Review of the topics Thermal stratification and Factors affecting light penetration for mid exams. | 2020-12-18 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Study hour and preparation for mid exams. Respiratory and Circulatory systems in fishes. | 2020-12-17 | 25 | 11 | 44 | 4 | 16 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Model test conducted on Anomalous properties of water. | 2020-12-16 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test on Skin of Fishes and Evaluation. | 2020-12-14 | 25 | 10 | 40 | 13 | 52 | Google Meet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | भवभूतिमहाकविः | 2020-12-13 | 120 | 67 | 56 | 65 | 56 | Ciscowebex | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | अनन्वयालङ्कारः। | 2020-12-12 | 120 | 65 | 56 | 64 | 56 | Ciscowebex | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Benthos ---- Classification, Types and distribution. | 2020-12-12 | 25 | 10 | 40 | 10 | 40 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test on Plankton and assessment of the answers. | 2020-12-11 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Conducted an elocution on different social problems including Human rights. | 2020-12-10 | 25 | 9 | 36 | 9 | 36 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Significance of Nekton in Food chain. | 2020-12-09 | 25 | 4 | 16 | 4 | 16 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Internal test on Nitrogen cycle and evaluation. | 2020-12-09 | 25 | 8 | 32 | 9 | 36 | Google Meet | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology tRNA | 2020-12-08 | 18 | 13 | 72 | 13 | 72 | Lecture discussion through Google meet & whiteboard | Click Here |
J. Kavitha | Mathematics | V sem | Maximal and prime ideals | 2020-12-08 | 79 | 52 | 66 | 52 | 66 | Google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Ecological importance of the Plankton. | 2020-12-08 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Structure and functions of skin in fishes. | 2020-12-07 | 25 | 15 | 60 | 13 | 52 | Google Meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | revision on SN1 SN2-Halogen compounds | 2020-12-05 | 49 | 37 | 75 | 37 | 75 | google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology-RNA types- m RNA | 2020-12-05 | 38 | 8 | 21.05 | 8 | 21.05 | Lecture method through Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Bio-mass variability of plankton and significance of plankton to fishes. | 2020-12-05 | 25 | 16 | 64 | 16 | 64 | Google Meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | SN1 SN2-Halogen compounds | 2020-12-04 | 49 | 28 | 57 | 28 | 57 | google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology-RNA types | 2020-12-04 | 24 | 6 | 25 | 6 | 25 | Lecture method through Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | African, Neotropical and Oriental regions. | 2020-12-04 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Types of Plankton and its distribution. | 2020-12-04 | 25 | 14 | 56 | 15 | 60 | Google Meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Active methylene compounds-synthetic applications | 2020-12-03 | 49 | 28 | 57 | 28 | 57 | googlemeet | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | limitation of microbial growth by nutrient supply | 2020-12-03 | 25 | 6 | 24 | 6 | 24 | google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology-RNA types | 2020-12-03 | 38 | 8 | 21.5 | 8 | 21.5 | Lecture method through Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Zoogeographical Realms with reference to the distribution of the Fresh water fishes. | 2020-12-03 | 25 | 7 | 28 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Major groups of Fresh water fishes and their distribution. | 2020-12-03 | 25 | 12 | 48 | 15 | 60 | Google Meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Active methylene compounds-preparation and hydrolysis | 2020-12-02 | 49 | 32 | 65 | 32 | 65 | googlemeet | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | microbial nutrition | 2020-12-02 | 25 | 8 | 32 | 12 | 48 | google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | English language skills to write the exams. | 2020-12-02 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Zoogeography of F.W fishes. | 2020-12-02 | 25 | 14 | 56 | 14 | 56 | Google Meet | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology : Splicing | 2020-12-01 | 18 | 12 | 67 | 12 | 67 | Discussion & Explanation with Google meeet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Active methylene compounds-ketoenol tautomerism | 2020-12-01 | 49 | 28 | 57 | 28 | 57 | googlemeet | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Genomic and cDNA LIBRARY | 2020-12-01 | 38 | 26 | 68.42 | 26 | 68.42 | Google class room .Lecture notes sharing | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | superficial mycoses | 2020-12-01 | 25 | 10 | 40 | 10 | 40 | google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Online Classes- Students’ attitude and discipline. | 2020-12-01 | 25 | 5 | 20 | 5 | 20 | Google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | https://docs.google.com/document/d/1Nr-tsOHDPzdIaJBeq7d5LLqbC8Fyw4e6yD21YW0KQSU/edit?usp=sharing | 2020-12-01 | 25 | 9 | 36 | 11 | 44 | Google Meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Metal carbonyls EAN CLASSIFICAION STRUCTURES | 2020-11-30 | 49 | 28 | 57 | 28 | 57 | GOOGLEMEET | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Polymerase chain reaction | 2020-11-30 | 38 | 26 | 68.42 | 26 | 68.42 | GOOGLE CLASS ROOM-NOTES AND ASSIGNMENT | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Gonado somatic index in fishes. | 2020-11-30 | 25 | 6 | 24 | 5 | 20 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Hormones in fishes. Conducted a test and Evaluation of the answers. | 2020-11-30 | 25 | 10 | 40 | 10 | 40 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | spectral problems | 2020-11-30 | 13 | 11 | 88 | 11 | 88 | zoom app sharing ppt | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology: 5'Capping & 3' poly A tail | 2020-11-30 | 18 | 12 | 67 | 12 | 67 | Explanation & discussion through Google meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | spectral problems | 2020-11-29 | 13 | 12 | 90 | 12 | 90 | zoom app sharing video and ppt | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | About Genome Project. | 2020-11-28 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Endocrine glands in fishes. | 2020-11-28 | 25 | 7 | 28 | 6 | 24 | Google Meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Metal carbonyls Ferrocene | 2020-11-28 | 49 | 35 | 71 | 35 | 71 | googlemeet | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Spectral problems | 2020-11-28 | 13 | 10 | 88 | 10 | 88 | Zoom meeting by sharing pdf | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Virus and its Mutations in view of corona. | 2020-11-27 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test conducted on factors affecting penetration of light. | 2020-11-27 | 25 | 4 | 16 | 4 | 16 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | astructure and synthesis of lysergic acid and synthesis of ergotamine | 2020-11-27 | 13 | 11 | 88 | 11 | 88 | zoom app sharing ppt | Click Here |
D.Vijaya Sree | Biochemistry | III Bsc Biochemistry B4,B6 | Mechanism of glucocorticoid | 2020-11-27 | 18 | 13 | 73 | 13 | 73 | class in zoom app | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Theories of bonding in metals band theory | 2020-11-27 | 49 | 21 | 43 | 21 | 43 | googlemeet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Zoogeography of fishes. | 2020-11-26 | 25 | 4 | 16 | 4 | 16 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Excretory, Nervous and Reproductive systems in general. | 2020-11-26 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | structural elucidation of Ergotamine | 2020-11-26 | 13 | 11 | 89 | 11 | 89 | zoom app sharing pp | Click Here |
D.Vijaya Sree | Biochemistry | III Bsc Biochemistry | Mechanism of harmone action | 2020-11-26 | 18 | 9 | 50 | 9 | 50 | class in zoom meetings app | Click Here |
D.Vijaya Sree | Biochemistry | II nd year Bsc biochemistry | principle of paper chromatography | 2020-11-26 | 35 | 14 | 40 | 14 | 40 | class in zoom meetings app | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Theories of bonding in metals free electronTheory | 2020-11-26 | 49 | 18 | 37 | 18 | 37 | google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology-DNA as genetic material | 2020-11-26 | 38 | 10 | 26.31 | 10 | 26.31 | Lecture method through Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Ionic regulation in fishes. | 2020-11-25 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Brief account on digestive, respiratory and blood vascular systems. | 2020-11-25 | 25 | 7 | 28 | 7 | 28 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | synthesis of yohimbine and spectral problems | 2020-11-25 | 13 | 10 | 88 | 10 | 88 | zoom app by sharing ppt | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Transcription mechanism discussion | 2020-11-25 | 18 | 10 | 57 | 10 | 57 | Discussion through Google meet with Youtube assistance | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Theories of bonding in metals VBT | 2020-11-25 | 49 | 22 | 45 | 22 | 45 | GOOGLE MEET | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology - RNA Types | 2020-11-25 | 24 | 9 | 37.5 | 9 | 37.5 | Lecture method through Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Identities of Inland waters. Productivity of a lake. | 2020-11-24 | 25 | 9 | 36 | 7 | 28 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test conducted on Reproductive structures. Evaluation and discussion of the answers. | 2020-11-24 | 25 | 10 | 40 | 8 | 32 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | synthesis of reserpine structural elucidation of yohimbine | 2020-11-24 | 13 | 9 | 70 | 9 | 70 | zoom app sharing ppt | Click Here |
B Dorka | Biochemistry | III BSc Biochem | RNA pol discussion Q & A | 2020-11-24 | 18 | 12 | 67 | 12 | 67 | Discussion through G-meet | Click Here |
D.Vijaya Sree | Biochemistry | II nd year Bsc biochemistry | introduction to chromatography | 2020-11-24 | 35 | 21 | 60 | 21 | 60 | class in zoom app | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Carbonyl compounds unit IV | 2020-11-24 | 49 | 28 | 57 | 28 | 57 | googlemeet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | structural elucidation of Reserpine | 2020-11-23 | 13 | 12 | 90 | 12 | 90 | zoom app sharing video and notes | Click Here |
D Vijaya Sree | Biochemistry | II nd Bsc biochemistry | summary of centrifugation | 2020-11-23 | 38 | 15 | 40 | 15 | 40 | zoom app | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 2020-11-23 | 41 | 14 | 39 | 14 | 39 | Black board | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology RNA pol Discussion | 2020-11-23 | 18 | 7 | 39 | 7 | 39 | Google meet discussion with youtube | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | Sructure of C Program | 2020-11-23 | 56 | 56 | 100 | 56 | 100 | Google classroom | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Carbonyl compounds unit IV | 2020-11-23 | 48 | 23 | 47 | 23 | 47 | googlemeet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Clarification of general doubts regarding the subject. | 2020-11-22 | 25 | 2 | 8 | 2 | 8 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | spectral problems | 2020-11-22 | 13 | 9 | 70 | 9 | 70 | zoom app by sharing video | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | assignment on alkalods | 2020-11-21 | 13 | 10 | 70 | 10 | 70 | zoom app | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology Mechanism of Transcription | 2020-11-21 | 18 | 18 | 100 | 18 | 100 | Lesson premiered through Youtube | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology-DNA as Genetic material | 2020-11-21 | 38 | 17 | 44.74 | 17 | 4744 | Lecture method through Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | English medium tips for Telugu medium students. | 2020-11-20 | 25 | 6 | 24 | 4 | 16 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test conducted on Thermal stratification. Evaluation & discussion of the answers submitted by the students. | 2020-11-20 | 25 | 5 | 25 | 4 | 16 | Google Meet | Click Here |
D. Krishna priya | Homescience | II bsc homescience | Housing needs in different stages of family life cycle | 2020-11-20 | 28 | 17 | 61 | 17 | 61 | Zoom | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- DNA Replication | 2020-11-20 | 24 | 16 | 66.67 | 16 | 66.67 | LE CTURE METHOD through ZOOM app using ppt | Click Here |
Dr. g.padmini devi | Homescience | III B.Sc. H.sc | factors influencing rate of adoption | 2020-11-20 | 24 | 17 | 70.3 | 17 | 70.3 | cisco webex | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | DNA genetic material | 2020-11-20 | 20 | 13 | 65 | 13 | 13 | Lecture method | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | rearangemeent of morphene to morphol , morphene to apomorphene and bio synthesis of alkalods | 2020-11-20 | 13 | 10 | 70 | 10 | 70 | zoom app | Click Here |
D.Vijaya Sree | BIO CHEMISTRY | III BSC BIO CHEM B4,B6 | organisation of harmones | 2020-11-20 | 18 | 10 | 56 | 10 | 56 | zoom | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Teaching the English medium skills for Telugu medium students. | 2020-11-19 | 25 | 6 | 36 | 6 | 36 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Significance of Mitotic divisions. Significance of Miotic division. | 2020-11-19 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | rearrangement of thebine to thebenine , structural elucidation by using all spectral data | 2020-11-19 | 13 | 11 | 88 | 11 | 88 | zoom app | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology-DNA Replication | 2020-11-19 | 38 | 15 | 39.47 | 15 | 39.47 | Lecture method through Zoom app -using DNA Replication ppt | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Universal gates | 2020-11-19 | 80 | 52 | 64 | 51 | 63 | CISCO WebEx | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | Harmones | 2020-11-19 | 18 | 11 | 61 | 11 | 61 | zoom meetings | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology - Basic Rules of Transcription _ Promoters , ... | 2020-11-19 | 18 | 18 | 100 | 18 | 100 | Lesson through Youtube telecast | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | multi step synthesis , synthesis of para bromo benzanilide | 2020-11-18 | 13 | 13 | 100 | 13 | 100 | zoom app by sharing ppt | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- DNA Structure | 2020-11-18 | 24 | 12 | 50 | 12 | 50 | Lecture method using ppt DNA structure through Zoom App | Click Here |
Dundi Krishna priya | Homescience | III B. Sc | Introduction to ECCE | 2020-11-18 | 24 | 19 | 79.17 | 17 | 70.83 | Cisco webex | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | sewage and its types, treatment of domestic sewage | 2020-11-18 | 25 | 12 | 48 | 15 | 60 | google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Logic gates | 2020-11-18 | 80 | 50 | 63 | 50 | 63 | CISCO WebEx | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology- RNA Pol Pro & Eukaryotic | 2020-11-18 | 18 | 18 | 100 | 18 | 100 | Lecture through Youtube | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | A test has been conducted on circulatory system. Evaluation of the answers. | 2020-11-18 | 25 | 9 | 36 | 8 | 32 | G Meet | Click Here |
M venkataramana | Commerce | III bcom general | Tender | 2020-11-17 | 50 | 13 | 26 | 13 | 26 | WebEx meeting app | Click Here |
N.Divyasri | Commerce | III B.com General | Soil erosion and conservation | 2020-11-17 | 50 | 17 | 34 | 17 | 34 | Explanation through webex | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | structure and synthesis of morphiene | 2020-11-17 | 13 | 11 | 88 | 11 | 88 | zoom app | Click Here |
Dr.Ch.Bhaskara Rao | Botany | 3 rd BSC,BZC -C1 Section | DNA Structure | 2020-11-17 | 40 | 20 | 50 | 20 | 59 | Lecture method using ppt on Strucure of DNA | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Self induction of long solenoid | 2020-11-17 | 80 | 51 | 63 | 61 | 63 | CISCO WebEx q | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Structure of the Heart in fishes Function of the Heart in fishes. | 2020-11-17 | 25 | 6 | 36 | 10 | 40 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Arterial system in fishes. Venous system in fishes. | 2020-11-17 | 25 | 10 | 40 | 11 | 44 | Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | indole alkaloids introduction and structural elucidaton of emetine | 2020-11-16 | 13 | 7 | 50 | 7 | 50 | zoom app | Click Here |
M venkataramana | Cost accounting | III bcom general | Tender | 2020-11-16 | 50 | 15 | 30 | 15 | 30 | WebEx meeting app | Click Here |
M venkataramana | Commerce | III bcom general | Rural and farm credit | 2020-11-16 | 50 | 14 | 28 | 14 | 28 | WebEx meeting app | Click Here |
N.Divyasri | Commerce | III B.com General | India Agriculture | 2020-11-16 | 13 | 13 | 100 | 13 | 100 | Explanation through webex | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Faraday laws | 2020-11-16 | 80 | 51 | 63 | 51 | 63 | Cisco WebEx | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Importance of English medium for competitive exams and future prospectus. | 2020-11-16 | 25 | 10 | 40 | 11 | 44 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Assignment on proton NMR spectra | 2020-11-15 | 13 | 5 | 44 | 5 | 44 | zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Discussion on the answers given by the students. | 2020-11-14 | 25 | 10 | 40 | 8 | 32 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | nuclear over houser effect , integration on proton NMR spectra | 2020-11-13 | 13 | 10 | 88 | 10 | 88 | zoom app | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Carbonyl compounds unit IV | 2020-11-13 | 102 | 34 | 33 | 34 | 33 | Googlemeet | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | Physical properties and preparation methods of phenol | 2020-11-13 | 79 | 42 | 53 | 42 | 53 | Cisco WebEx | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test conducted on Anomalous properties of water. | 2020-11-13 | 25 | 8 | 32 | 8 | 32 | Google Meet | Click Here |
Latha B | GCW | II BSc A1, B3, B4, B6 | Hydroboration and Grignard addition for the preparation of alcohols | 2020-11-12 | 79 | 36 | 45 | 36 | 45 | Cisco WebEx App | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology- Basic Rules of Transcription | 2020-11-12 | 18 | 6 | 33 | 6 | 33 | Lecture explanation in Google meet with Whiteboard | Click Here |
Anusha K | CHEMISTRY | III SEM B.Sc. | Carbonyl compounds unit IV | 2020-11-12 | 102 | 21 | 20 | 21 | 20 | GOOGLE MEET | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Joule Kelvin cooling | 2020-11-12 | 77 | 29 | 37.66 | 29 | 37.66 | Webex app ppt presentation | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Various physiological activities in brief. Different embryonic stages in brief. | 2020-11-12 | 25 | 6 | 24 | 4 | 16 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | temperature dependent NMR Spectroscopy | 2020-11-12 | 13 | 10 | 88 | 10 | 88 | zoom app | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Identification of structure of unknown compounds using proton nmr spectroscopy | 2020-11-11 | 13 | 7 | 50 | 7 | 50 | zoom app | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamic scale of temperature | 2020-11-11 | 77 | 26 | 33.77 | 26 | 33.77 | Webex app | Click Here |
Latha B | GCW | II BSc A1, B3, B4, B6 | Synthesis of Alcihols | 2020-11-11 | 79 | 39 | 49.3 | 39 | 49.3 | Cisco WebEx App | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test conducted on Respiratory system in fishes. Evaluation and discussion on the answers given by the students. | 2020-11-11 | 25 | 5 | 25 | 7 | 28 | Google Meet | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Digging--poem | 2020-11-10 | 30 | 11 | 37 | 11 | 100 | Zoom | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | interpretation of chemical shifts in proton nmr cs values | 2020-11-10 | 13 | 11 | 88 | 11 | 88 | through zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Summary of Organizational levels. Contd the organizational levels in Animal kingdom. | 2020-11-10 | 25 | 7 | 28 | 8 | 32 | Google Meet | Click Here |
Latha B | GCW | II BSc A1, B3, B4, B6 | Hydroxy Compounds | 2020-11-09 | 79 | 37 | 46 | 37 | 46 | Cisco Webex | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Potus plug experiment | 2020-11-09 | 77 | 29 | 36.77 | 29 | 36.77 | Webex app ppt | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | De Morgan's laws and logic gates | 2020-11-09 | 85 | 65 | 76 | 65 | 76 | Google classroom | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Dynamic proton NMR DEUTERIUM EXCHANGE METHODS | 2020-11-09 | 13 | 11 | 88 | 11 | 88 | through zoom app by sharing ppt | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Types of Symmetry and Body cavity.,Importance of education in woman’s life. | 2020-11-09 | 25 | 7 | 28 | 7 | 28 | Google meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | simplification of complex spectra into first order spectra | 2020-11-08 | 13 | 12 | 92 | 12 | 92 | zoom meeting by sharing ppt | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | simplification of non first to first order spectra | 2020-11-07 | 13 | 12 | 92 | 12 | 92 | zoom app by sharing ppt | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Once upon a time_poem | 2020-11-07 | 30 | 9 | 30 | 9 | 100 | Zoom | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Half adder & full adder | 2020-11-07 | 80 | 72 | 90 | 72 | 90 | Whatsapp PPT sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Fundamentals of zoology. Ethics and Human values. | 2020-11-07 | 25 | 3 | 12 | 3 | 12 | Google Meet | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology : Transcription RNA pol | 2020-11-06 | 19 | 8 | 42 | 8 | 42 | Lecture Explanation with Whiteboard on Google meet | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Once upon a time_poem | 2020-11-06 | 30 | 18 | 60 | 18 | 100 | Zoom app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | De Morgan's laws, nand & nor gates | 2020-11-06 | 80 | 72 | 90 | 72 | 90 | Whatsapp ppt sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | chemical shift problems spin spin interactions to first order spectra | 2020-11-06 | 13 | 11 | 88 | 11 | 88 | zoom app by sharing ppt | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Role of Co2 in chemical buffering. Significance of 7.4 PH in blood. | 2020-11-06 | 25 | 6 | 24 | 6 | 24 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | stereo chemistry of phenanthrene alkaloids | 2020-11-05 | 13 | 10 | 77 | 10 | 77 | zoom app | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Transcription Introduction | 2020-11-05 | 19 | 8 | 42 | 8 | 42 | Lecture Discussion through whiteboard & Google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Logic gates | 2020-11-05 | 72 | 72 | 100 | 72 | 100 | Click Here | |
M.Indiramma | English | IIBSc _A6,A7,A8 | Shyness,Myshield | 2020-11-05 | 30 | 14 | 46 | 14 | 100 | Zoom app | Click Here |
D. Krishna Priya | Home science | II bsc | Factors influencing selection of site | 2020-11-04 | 28 | 17 | 61 | 17 | 61 | Zoom | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | stereo chemistry of cinchona alkaloids | 2020-11-04 | 13 | 10 | 77 | 10 | 77 | zoom app sharing ppt | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Replication Revision & College reopening details with COVID safety | 2020-11-04 | 19 | 9 | 47 | 9 | 47 | Google meet - Lecture discussion | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Low temperature physics | 2020-11-04 | 77 | 24 | 31.17 | 24 | 31.17 | Webex app PPT PRESENTATION | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | A test has been conducted on chemical buffering. Discussion on the answers written in a test. | 2020-11-04 | 25 | 9 | 36 | 6 | 24 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | PH scale vs H+ ion concentration. | 2020-11-04 | 25 | 3 | 12 | 3 | 12 | Google meet | Click Here |
D. Krishna Priya | Home science | III bsc | Status of ECE during pregnancy and post independence period | 2020-11-03 | 28 | 17 | 61 | 17 | 61 | Zoom | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | what is life? various biochemical reactions in protoplasm. | 2020-11-03 | 25 | 9 | 36 | 8 | 32 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Fundamentals & concept Orientation of zoology. | 2020-11-02 | 25 | 10 | 40 | 7 | 28 | Google Meet | Click Here |
D. Krishna Priya | Home science | II bsc | Housing and interior decoration quiz | 2020-10-31 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-31 | 23 | 17 | 70 | 17 | 70 | Google forms | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Oviparity in Marine and F.W fishes with examples. Ovo-Viviparity and Viviparity in fishes with examples. | 2020-10-31 | 25 | 7 | 28 | 7 | 28 | Google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Parental care in fishes. | 2020-10-31 | 25 | 5 | 20 | 6 | 24 | Google Meet | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-30 | 23 | 17 | 70 | 17 | 70 | Google forms | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | classification of NMR spectra | 2020-10-30 | 13 | 8 | 70 | 8 | 70 | zoom app by using ppt | Click Here |
Latha B | GCW | II BSc A1, B3, B4, B6 | SN Reactions | 2020-10-30 | 79 | 38 | 48 | 38 | 48 | Cisco WebEx APp | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Reproductive structures in Teleosts. Discussion on Maturity of Gonads in general. | 2020-10-30 | 25 | 7 | 28 | 6 | 24 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Maturity stages of female gonads in fishes. Gonadosomatic Index (GSI) and Fecundity in fishes. | 2020-10-30 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
D. Krishna Priya | Home science | II bsc | Housing and interior decoration quiz | 2020-10-29 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-29 | 23 | 17 | 70 | 17 | 70 | Google forms | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | sin spin interactions coupling constants types of coupling constant | 2020-10-29 | 13 | 7 | 61 | 8 | 61 | zolom meeting by sharing ppt | Click Here |
Latha B | GCW | II BSc A1, B3, B4, B6 | Classification and Reactivity of Halogen Compounds | 2020-10-29 | 79 | 34 | 43 | 34 | 43 | Cisco WebEx App | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Phosphorous cycle. Shared the study material for the topics covered in ichthyology. | 2020-10-29 | 25 | 7 | 28 | 5 | 25 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | T.S of Testis and Ovary in fishes. Reproductive structures in Elasmobranchs. | 2020-10-29 | 25 | 8 | 32 | 7 | 28 | Google Meet | Click Here |
D. Krishna Priya | Homescience | III bsc | Ecce | 2020-10-28 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-28 | 23 | 15 | 70 | 15 | 70 | Google forms | Click Here |
Latha B | GCW | II BSc A1, B3, B4, B6 | Halogen Compounds | 2020-10-28 | 65 | 37 | 49.3 | 37 | 49.3 | Cisco WebEx | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | chemical shift factors effecting chemical shift | 2020-10-28 | 13 | 10 | 88 | 10 | 88 | zoom meeting by sharing ppt | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Role of CO2 in chemical buffering. Bicarbonate buffering system in blood. | 2020-10-28 | 25 | 6 | 24 | 5 | 20 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Nitrogen cycle. | 2020-10-28 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
D. Krishna Priya | Home science | III bsc | Ecce quiz | 2020-10-27 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-27 | 23 | 19 | 90 | 19 | 90 | Google forms | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Important terminologies in NMR SPECTROSCOPY | 2020-10-27 | 13 | 11 | 88 | 11 | 88 | zoom meeting | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | A video on chemical buffering has been presented. Discussion on chemical buffering. | 2020-10-27 | 25 | 7 | 28 | 8 | 32 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Why is PH important in animals? Reasons for natural variations in PH. | 2020-10-27 | 25 | 10 | 40 | 8 | 32 | Google Meet | Click Here |
D. Krishna Priya | Home science | III bsc | Ecce bits | 2020-10-26 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-26 | 23 | 15 | 60 | 15 | 60 | Google forms | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Introduction and basic principle of NMR Spectroscopy | 2020-10-26 | 13 | 10 | 88 | 10 | 88 | Zoom meeting | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Review on 2nd semester examinations. Sharing the materials (notes) for the topics covered. | 2020-10-26 | 25 | 9 | 36 | 7 | 28 | Google Meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Acidic, Basic and Buffer solutions. Importance of PH for smooth functioning of life processes. | 2020-10-26 | 25 | 7 | 28 | 5 | 20 | Google Meet | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-25 | 23 | 15 | 55 | 15 | 55 | Google forms | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-24 | 23 | 16 | 60 | 16 | 60 | Google forms | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Structural elucidation by using IR spectra | 2020-10-24 | 13 | 10 | 88 | 10 | 88 | Zoom meeting by sharing ppt | Click Here |
D. Krishna Priya | Homescience | III bsc | Ecce | 2020-10-23 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Interior station of inorganic compounds by using IR Spectra | 2020-10-23 | 13 | 10 | 88 | 10 | 88 | Zoom meeting | Click Here |
Anusha Karumuri | chemistry | B.Sc. IIIsem | F-BLOCK separation of lanthanides | 2020-10-23 | 102 | 28 | 27 | 28 | 27 | google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- Chromosome-Solenoid model | 2020-10-23 | 24 | 12 | 50 | 12 | 50 | Lecturer method through Zoom meeting using ppt Chromosomes | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Google quiz on nutrition | 2020-10-23 | 23 | 19 | 70 | 19 | 70 | Google forms | Click Here |
D. Krishna Priya | Homescience | III bsc | Ecce bits | 2020-10-22 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
Anusha Karumuri | chemistry | B.Sc. IIIsem | f-block | 2020-10-22 | 102 | 36 | 35 | 27 | 26 | lecture | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | IR sestra vibrational frequency ,factors effecting vibrational frequency in inorganic compounds | 2020-10-22 | 13 | 7 | 50 | 7 | 50 | Zoon meeting by sharing ppt | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | interpretatin of ESR Spectra | 2020-10-21 | 13 | 7 | 50 | 7 | 50 | zoom meeting sharing ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology, viruses | 2020-10-21 | 38 | 15 | 40 | 15 | 40 | Google meet | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Online quiz on nutrition | 2020-10-21 | 23 | 17 | 70 | 17 | 70 | Google forms | Click Here |
D. Krishna Priya | Home science | III bsc | Ecce quiz | 2020-10-20 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology | 2020-10-20 | 38 | 26 | 72 | 26 | 72 | Video lesson shared through WhatsApp group | Click Here |
Dr S J M PRATHAP KUMAR | Zoology | III MZC BiZC | Indigenous cattle breeds | 2020-10-20 | 30 | 8 | 26.67 | 8 | 26.67 | Google meet PowerPoint presentation shared | Click Here |
B.Swetha Rani Bai | Bakery and confectionary | III B.Sc Home science | Practical orientation classe | 2020-10-20 | 23 | 16 | 78 | 15 | 75 | Zoom meetings | Click Here |
D. Krishna Priya | Home science | II bsc | Housing and interior decoration | 2020-10-19 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Community nutrition bits | 2020-10-19 | 23 | 21 | 95 | 21 | 95 | Google forms | Click Here |
B.Swetha Rani Bai | Bakery and confectionary | III B.Sc Home science | Rheological prosperities | 2020-10-17 | 23 | 13 | 55 | 13 | 55 | Zoom meetings | Click Here |
D. Krishna Priya | Home science | III bsc | Early childhood care and education | 2020-10-17 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
D. Krishna Priya | Home science | IIbsc | Housing and interior decoration quiz | 2020-10-17 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Communication skills for dietitian | 2020-10-16 | 23 | 14 | 55 | 14 | 55 | Zoom meetings | Click Here |
D. Krishna Priya | Home science | II bsc | Housing and interior decoration | 2020-10-16 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Hormonal regulation in reproduction. Revision Moulting and Metamorph | 2020-10-15 | 25 | 11 | 44 | 11 | 44 | Google Meet | Click Here |
B.Swetha Rani Bai | Therapeutic nutrition bits | III B.Sc Home science | Bits quiz | 2020-10-15 | 23 | 17 | 70 | 17 | 70 | Google forms | Click Here |
D. Krishna Priya | Home science | III bsc | Ecce quiz | 2020-10-15 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | electron spin resonance spectroscopy of organic compounds | 2020-10-14 | 13 | 11 | 88 | 11 | 88 | zoom meeting by screen share | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Hardy-Weinberg Law of Equilibrium. Revision Convergent and Divergent Evolution. | 2020-10-14 | 25 | 8 | 32 | 6 | 36 | Google Meet | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Nutrition care process | 2020-10-14 | 23 | 15 | 55 | 15 | 55 | Zoom meeting | Click Here |
D. Krishna Priya | Home science | II bsc | Housing and interior decoration quiz | 2020-10-14 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Inborn errors of metabolism. Revision Chromosomal abnormalities. | 2020-10-13 | 25 | 10 | 40 | 10 | 40 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | electron spin resonance spectroscopy selection rule and principle | 2020-10-13 | 13 | 10 | 70 | 10 | 70 | zoom meeting | Click Here |
B.Swetha Rani Bai | Bakery and confectionary | III B.Sc Home science | Types of flours | 2020-10-13 | 23 | 14 | 55 | 14 | 55 | Zoom meetings | Click Here |
D. Krishna Priya | Homescience | III bsc | Ecce quiz | 2020-10-13 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Propagation of Nerve Impulse. Revision Synaptic transmission. | 2020-10-12 | 25 | 10 | 40 | 9 | 36 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Flow methods,Relaxation methods,Flash photolysis | 2020-10-12 | 13 | 8 | 62 | 8 | 62 | Zoom App Screen Sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | interpretation of IR values to inorganic compounds | 2020-10-12 | 13 | 8 | 50 | 8 | 50 | zoom meeting | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Role of dietitian | 2020-10-12 | 23 | 15 | 60 | 15 | 60 | Zoom meetings | Click Here |
D. Krishna Priya | Homescience | II bsc | Housing and interior decoration quiz | 2020-10-12 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Blood group Inheritance. Revision Concept of Eugenics. | 2020-10-11 | 25 | 10 | 40 | 6 | 24 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | assignment | 2020-10-11 | 13 | 11 | 88 | 11 | 88 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Corrosion,Fuel Cells | 2020-10-11 | 13 | 5 | 39 | 5 | 39 | Zoom App Screen Sharing | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | nutrition impairment and stress,plague disease diagnosis and its control | 2020-10-11 | 25 | 10 | 40 | 10 | 40 | Google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Sex determination. Revision Sex-Linked Inheritance. | 2020-10-10 | 25 | 10 | 40 | 10 | 40 | Google Meet | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | tuberculosis | 2020-10-10 | 25 | 7 | 28 | 10 | 40 | Google meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | interpretatin of IR spectra | 2020-10-10 | 13 | 11 | 88 | 11 | 88 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | UV -Polyatomic molecuies | 2020-10-10 | 13 | 10 | 77 | 10 | 77 | Zoom App Screen Sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | interpretation of IR values to organic compounds | 2020-10-09 | 13 | 10 | 70 | 10 | 70 | zoom meeting | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Revision Human Genome Project. Revision Pedigree Analysis. | 2020-10-09 | 25 | 13 | 52 | 10 | 40 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Uv Rotational Fine Structure | 2020-10-09 | 13 | 5 | 39 | 5 | 39 | Zoom App Screen Sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Path ways of cellular metabolism revised. Notes prepared and shared. | 2020-10-08 | 25 | 15 | 60 | 12 | 48 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | comparisons of ir values with examples | 2020-10-08 | 13 | 8 | 61 | 8 | 61 | zoom meetibg | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | UV-Vibrational Coarse structure | 2020-10-08 | 13 | 4 | 31 | 4 | 31 | Zoom App Screen Sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Process of digestion and absorption. Notes prepared and shared. | 2020-10-07 | 25 | 12 | 48 | 10 | 40 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | interpretatin of IR spectra | 2020-10-07 | 13 | 8 | 61 | 8 | 61 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | IR-Anharmonic oscillator | 2020-10-07 | 13 | 5 | 39 | 5 | 39 | Zoom App Screen Sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Behavioral genetics in Drosophila. Behavioral genetics in Bees. | 2020-10-06 | 25 | 12 | 48 | 10 | 40 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | reactions of organometallic compounds | 2020-10-06 | 13 | 11 | 88 | 11 | 88 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | IR -SHO | 2020-10-06 | 13 | 7 | 54 | 6 | 46 | Zoom App screen sharing | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Bits quiz | 2020-10-06 | 24 | 19 | 70 | 19 | 70 | Google forms | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Sources and Losses of Co2 in lake waters. Distribution patterns of co2 in lake waters. | 2020-10-05 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | vibrational frequency of amines nitro compounds 1 3 di ketones | 2020-10-05 | 13 | 10 | 85 | 10 | 85 | by lecture method using screen sharing through zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Kempferol Constitution,synthesis,Stereochemistry | 2020-10-05 | 13 | 8 | 62 | 8 | 62 | ZoomApp Screen Sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | assignment | 2020-10-04 | 13 | 11 | 88 | 11 | 88 | through zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | ESR spectra H.,CH3.,BSQ | 2020-10-04 | 13 | 6 | 46 | 5 | 39 | Zoom App Screen sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Videos on muscle contraction are presented. Muscle contraction, sliding filament theory. | 2020-10-03 | 25 | 5 | 25 | 5 | 25 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | vibrational frequency of ether carbonyl compounds and amides | 2020-10-03 | 13 | 11 | 88 | 11 | 88 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Quercetin Constitution,Synthesis | 2020-10-03 | 13 | 7 | 54 | 7 | 54 | Zoom App Screen Sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Functions of the muscles. Structure of Actin and Myosin filaments. | 2020-10-02 | 25 | 7 | 28 | 5 | 25 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | vibrational frequency of anhydrides, acids and esters | 2020-10-02 | 13 | 11 | 88 | 11 | 88 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Flavanoids | 2020-10-02 | 13 | 12 | 92 | 12 | 92 | Zoom App screen sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Striated, Non striated and Cardiac Muscle fibers. Ultra structure of the striated muscle. | 2020-10-01 | 25 | 6 | 36 | 6 | 36 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | ESR Hyperfine splitting | 2020-10-01 | 13 | 6 | 46 | 5 | 39 | Zoom App Screen Sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Assignment on named reactions | 2020-10-01 | 13 | 11 | 88 | 11 | 88 | through zoom meeting | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Assignment 3 | 2020-09-30 | 13 | 7 | 50 | 7 | 50 | zoom meeting | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | O2 depletion problems in fish ponds. Control mechanisms of O2 depletion in fish ponds. | 2020-09-30 | 25 | 9 | 36 | 6 | 24 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | NMR Spin Spin coupling examples | 2020-09-30 | 13 | 6 | 46 | 5 | 39 | Zoom App Screen sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | Energy profile diagram and mechanism of substitution reactions SN1 &SN2 reactions | 2020-09-29 | 13 | 7 | 50 | 7 | 50 | Through zoom meeting by lecture method | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Sources & Losses of D.O in aquatic environments. Distribution patterns of D.O in aquatic environment. | 2020-09-29 | 25 | 10 | 40 | 8 | 32 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | NMR Spin Spin coupling examples | 2020-09-29 | 13 | 5 | 39 | 5 | 39 | Zoom App screen sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Two Videos on Dissolved Oxygen have been presented. Relationship between dissolved oxygen and aquatic life. | 2020-09-28 | 25 | 9 | 36 | 8 | 32 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | NMR Spin Spin coupling | 2020-09-28 | 13 | 4 | 31 | 4 | 31 | Zoom App screen sharing | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | structural elucidation of atropiene camphor and berberine | 2020-09-28 | 13 | 7 | 50 | 7 | 50 | zoom meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Functions of the Brain in fishes. Test on “Structure and functions of the brain in fishes” has been conducted in goggle f | 2020-09-26 | 25 | 10 | 40 | 8 | 32 | Google Meet | Click Here |
Y.LakshmiPrasanna | Chemistry | M.Sc chemistry II year | named reactions and mechanisms part 4 | 2020-09-26 | 13 | 5 | 39 | 5 | 39 | zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | MW Spectra Rigid rotator DAM | 2020-09-26 | 13 | 4 | 31 | 4 | 31 | Zoom App screen Sharing | Click Here |
B.Swetha Rani Bai | Bakery and confectionary | III B.Sc Home science | Maintenance of equipment | 2020-09-26 | 23 | 15 | 70 | 15 | 70 | Zoom meetings | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | factors effecting substitution reactions | 2020-09-25 | 13 | 5 | 39 | 5 | 39 | zoom meeting | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Brain Structure in detail. Structure of the brain in Elasmobranchs. | 2020-09-25 | 25 | 14 | 56 | 12 | 48 | google meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Structure of the brain in elasmobranchs contd. Structure of the brain in Teleosts. | 2020-09-25 | 25 | 8 | 32 | 8 | 32 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Energy of molecules,Types of spectra | 2020-09-25 | 13 | 6 | 46 | 4 | 31 | Zoom App screen sharing | Click Here |
B.Swetha Rani Bai | Bakery and confectionary | III B.Sc Home science | Maintenance of equipment | 2020-09-25 | 23 | 17 | 70 | 17 | 70 | Zoom meetings | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpinoids Biosynthesis | 2020-09-24 | 13 | 8 | 62 | 7 | 54 | Zoom app Screen sharing | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | protection of acids alcohols carboxylic acids | 2020-09-24 | 13 | 7 | 44 | 7 | 44 | zoom app | Click Here |
B.Swetha Rani Bai | Bakery and confectionary | III B.Sc Home science | Equipment classification | 2020-09-24 | 23 | 13 | 55 | 13 | 55 | Zoom meetings | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Duplicate genes, modifier genes. Cumulative genes, Lethal genes. | 2020-09-23 | 25 | 11 | 44 | 11 | 44 | google meet | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | protecting groups part 2 | 2020-09-23 | 13 | 8 | 61 | 8 | 61 | by lecture method through zoom app | Click Here |
M venkataramana | Commerce | II bcom general | Income from other sources | 2020-09-23 | 50 | 30 | 60 | 30 | 60 | Material send to whatsapp group | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpinoids Biosynthesis | 2020-09-23 | 13 | 6 | 46 | 5 | 39 | Zoom App screen sharing | Click Here |
B.Swetha Rani Bai | Home science | III B.Sc Home science | Equipment classification | 2020-09-23 | 23 | 15 | 60 | 15 | 60 | Zoom meetings | Click Here |
D. Krishna Priya | Homescience | II bsc | Types of house | 2020-09-23 | 24 | 15 | 63 | 15 | 63 | Zoom | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Recessive Epistasis with example. Dominant Epistasis with example. | 2020-09-22 | 25 | 8 | 32 | 8 | 32 | Google Meet | Click Here |
M venkataramana | Commerce | II bcom general | Income from salary | 2020-09-22 | 50 | 15 | 30 | 15 | 30 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | Elimination reactions | 2020-09-22 | 13 | 5 | 39 | 5 | 39 | by lecture method through zoom app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpenoids,Abietic acid Constitution | 2020-09-22 | 13 | 6 | 46 | 6 | 46 | Zoom App screen sharing | Click Here |
D. Krishna Priya | Home science | II bsc | Housing and interior decoration quiz | 2020-09-21 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Interaction of genes Complementary genes, Supplementary genes. | 2020-09-21 | 25 | 8 | 32 | 8 | 32 | Google Meet | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | alkaloids | 2020-09-21 | 13 | 8 | 61 | 8 | 61 | By lecture method | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpenoids,Abietic acid Constitution | 2020-09-21 | 13 | 5 | 39 | 5 | 39 | ZOOM APP screen sharing | Click Here |
M venkataramana | Commerce | II bcom general | Deduction 80c to 80u | 2020-09-21 | 50 | 16 | 32 | 16 | 32 | Coscx WebEx meeting app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | actors affecting Light penetration into natural waters Continuation of the above said Topic. | 2020-09-19 | 25 | 11 | 44 | 9 | 36 | Google Meet | Click Here |
B.Swetha Rani Bai | Home science | III B.Sc Home science | Small equipment | 2020-09-19 | 23 | 15 | 60 | 15 | 60 | Zoom web meetings | Click Here |
M venkataramana | Commerce | II bcom general | Total income | 2020-09-19 | 50 | 11 | 22 | 11 | 22 | Coscx WebEx meeting app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Thermal Classification of Lakes Thermal Classification of Lakes contd. | 2020-09-18 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
M venkataramana | Commerce | II bcom general | Total income | 2020-09-18 | 50 | 10 | 20 | 10 | 20 | Coscx WebEx meeting | Click Here |
D. Krishna Priya | Homescience | III bsc | Need for ece centres | 2020-09-18 | 24 | 15 | 63 | 15 | 63 | Zoom | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Winter Stagnation, Spring Overturn, Summer Stratification and Fall Overturn.Overall Impact of Thermal stratification on Plants a | 2020-09-17 | 25 | 13 | 52 | 13 | 52 | Google Meet | Click Here |
M venkataramana | Commerce | II bcom general | Total income | 2020-09-17 | 50 | 19 | 38 | 19 | 38 | Coscx WebEx meeting app | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | analysis of mixture, elimination of interfering anion less femiliar cations | 2020-09-17 | 13 | 8 | 70 | 9 | 70 | by lecture method | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpenoids,Eudesmol Constitution | 2020-09-17 | 13 | 11 | 85 | 11 | 85 | Zoom App Screen Sharing | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Thermal Stratification Introduction.A video on Thermal Stratification has been presented. | 2020-09-16 | 25 | 10 | 40 | 10 | 40 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpenoids,Santonin Constitution | 2020-09-16 | 13 | 5 | 39 | 4 | 31 | ZoomApp--Screen sharing | Click Here |
M venkataramana | Commerce | I Bcom Computer Banking | Depreciation | 2020-09-16 | 50 | 30 | 60 | 30 | 60 | Material send to whatsapp group | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | protecting groups | 2020-09-16 | 13 | 5 | 44 | 5 | 44 | by lecture method | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Heart in Elasmobranchs and in TeleostsArterial and Venous systems in Elasmobranchs and Teleosts. | 2020-09-15 | 25 | 12 | 48 | 12 | 48 | google meet | Click Here |
G.sita | Electronics | II B.Sc | Gray Code Conversion | 2020-09-15 | 30 | 10 | 33.3 | 10 | 33.3 | Zoom App | Click Here |
G.sita | Electronics | III B.Sc | power in AM wave | 2020-09-15 | 25 | 12 | 48 | 12 | 48 | zoom app | Click Here |
M venkataramana | Commerce | I Bcom Computer & Banking | Depreciation | 2020-09-15 | 50 | 40 | 80 | 40 | 80 | Material send to whatsapp group | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpenoids,Zinziberine Constitution | 2020-09-15 | 13 | 8 | 62 | 7 | 54 | ZoomApp meeting---Screensharing | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | orgel and ts diadrams and term symbols | 2020-09-15 | 13 | 8 | 61 | 8 | 61 | by lecture method through zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Q & A to Students Ethical Values and Morals | 2020-09-14 | 25 | 15 | 60 | 12 | 48 | google meet | Click Here |
G.sita | Electronics | II B.Sc | Logic Gates | 2020-09-14 | 30 | 12 | 40 | 12 | 40 | Zoom App | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpenoids,Isoprene rule,Classification | 2020-09-14 | 13 | 7 | 54 | 5 | 39 | Zoom App meeting screen sharing | Click Here |
M venkataramana | Commerce | II bcom computer | function of RBI | 2020-09-14 | 50 | 30 | 60 | 30 | 60 | PPT sent to whatsapp group | Click Here |
Dr. Venkateswara Rao Bodepudi | Hindi | All | Hindi Day Celebration | 2020-09-14 | 15 | 15 | 100 | 15 | 100 | Jio Meet https://jiomeetpro.jio.com/shortener?scheduledmeeting=true&hash=A0YC9qei-3d640abe1fd301600003056317%40Db4zB&pwd=Db4zB | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | named reactions and mechanisms part 3 | 2020-09-14 | 13 | 7 | 50 | 7 | 50 | by lecture method | Click Here |
D. Krishna Priya | Home science | II bsc | Terms related to housing | 2020-09-14 | 24 | 15 | 63 | 15 | 73 | Zoom | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Assignment exam | 2020-09-13 | 77 | 6 | 7.8 | 6 | 7.8 | Webex app and Google Classroom | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | named reactions and mechanisms part 2 | 2020-09-13 | 13 | 8 | 61 | 8 | 61 | by lecture method through zoom meeting using ppt | Click Here |
G.sita | Electronics | II B.Sc | Octal,hexadecimal conversions | 2020-09-12 | 30 | 11 | 36 | 11 | 36 | Zoom app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Terpinoids Sources,Isolation | 2020-09-12 | 13 | 4 | 31 | 4 | 31 | ZOOM APP Screen sharing | Click Here |
Y.LakshmiPrasanna | chemistry | M.Sc chemistry II year | named reactions and mechanisms | 2020-09-12 | 13 | 8 | 61 | 8 | 61 | by lecture method through zoom meeting | Click Here |
D. Krishna Priya | Homescience | III Bsc | Introduction to ECCE | 2020-09-12 | 24 | 15 | 63 | 15 | 63 | Zoom | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | One Video has been presented on Mendel’s LawsOne Video has been presented on a fish heart and explained. | 2020-09-12 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | electronic spectroscopy | 2020-09-11 | 13 | 7 | 50 | 7 | 50 | lecture method through zoom meeting | Click Here |
M venkataramana | Commerce | II bcom general | Self occupied for HP | 2020-09-11 | 50 | 19 | 38 | 19 | 38 | Coscx WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom general | RTI act | 2020-09-11 | 50 | 20 | 40 | 20 | 40 | PPT sent to whatsapp group | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides Rotenoids--2 | 2020-09-11 | 13 | 4 | 31 | 4 | 31 | ZOOM APP SCREEN SHARE | Click Here |
G.sita | Electronics | III B.Sc | Side band frequency of AM | 2020-09-11 | 25 | 12 | 48 | 12 | 48 | zoom app | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Introduction to diet counseling | 2020-09-11 | 24 | 14 | 70 | 14 | 70 | PowerPoint presentation | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Introduction to diet counseling | 2020-09-11 | 24 | 14 | 70 | 14 | 70 | PowerPoint presentation | Click Here |
D. Krishna Priya | Homescience | II bsc | Introduction to housing | 2020-09-11 | 24 | 15 | 63 | 63 | 63 | Zoom | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Pituitary gland, Thyroid and Adreno cortical tissue in fishes.chromaffin tissue, Corpuscles of Stannious, Ultimo branchial gland | 2020-09-11 | 25 | 14 | 56 | 14 | 56 | Google Meet | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Elongation & Termination of Replication | 2020-09-10 | 18 | 8 | 44.5 | 8 | 44.5 | Lecture Discussion through Google meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Assignment exam | 2020-09-10 | 77 | 23 | 29.9 | 23 | 29.9 | Webex app and Google Classroom | Click Here |
M venkataramana | Commerce | II bcom general | Pre contraction interest HP | 2020-09-10 | 50 | 20 | 40 | 20 | 40 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | I Bcom Computer Banking | Depreciation | 2020-09-10 | 50 | 34 | 68 | 34 | 68 | Coscx WebEx meeting app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides Rotenoids | 2020-09-10 | 13 | 4 | 31 | 3 | 23 | zoom app ---screen sharing | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | cotton effect faraday effect | 2020-09-10 | 13 | 7 | 50 | 7 | 50 | lecture method through zoom meeting | Click Here |
G.sita | Electronics | II B.Sc | Conversion of Number Systems form one form to another form | 2020-09-10 | 30 | 11 | 36 | 11 | 36 | zoom app | Click Here |
G.sita | Electronics | III B.Sc | Analysis of AM | 2020-09-10 | 25 | 10 | 40 | 10 | 40 | Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Specific heat, Latent heat, Surface tension etc, of water.Anomalous expansion and contraction of water, it’s influence on Biot | 2020-09-10 | 25 | 10 | 40 | 10 | 40 | google meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Specific heat relations | 2020-09-09 | 77 | 18 | 23.37 | 18 | 23.37 | Webex app | Click Here |
M venkataramana | Commerce | II bcom general | House property | 2020-09-09 | 50 | 20 | 40 | 20 | 40 | Coscx WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom general | Agreement | 2020-09-09 | 50 | 20 | 40 | 20 | 40 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides Pachyrrhizin,Anonaine | 2020-09-09 | 13 | 5 | 39 | 4 | 31 | -Zoom App screen share---Lecture method | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Organic named reactions | 2020-09-09 | 13 | 7 | 50 | 7 | 50 | Lecture method using zoom meeting | Click Here |
G.sita | Electronics | III B.Sc | Number System in Digital Electronics | 2020-09-09 | 30 | 11 | 36 | 11 | 36 | Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Anomalous properties of water, Structure of water molecule. Cohesion and Adhesion, It’s influence on biota in Inland waters. | 2020-09-09 | 25 | 10 | 40 | 10 | 40 | google meet | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-09-08 | 50 | 22 | 44 | 22 | 44 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-09-08 | 50 | 29 | 58 | 29 | 58 | Coscx WebEx meeting app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides Spilanthol | 2020-09-08 | 13 | 6 | 46 | 6 | 46 | Zoom app screen sharing--Lecture ethod | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Material for electromagnetic induction | 2020-09-08 | 75 | 63 | 84 | 63 | 84 | Google classroom | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | electronic spectroscopy | 2020-09-08 | 13 | 7 | 50 | 7 | 50 | through zoom meeting by lecture method | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Initiation of Replication | 2020-09-08 | 18 | 11 | 61 | 11 | 61 | Lecture Discussion through Google Meet | Click Here |
G.sita | Electronics | III B.Sc | Need for modulation | 2020-09-08 | 25 | 12 | 48 | 12 | 48 | Zoom app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test conducted in Google form on 8-9-2020 2-4.30pm Test Conducted on 8-9-2020 2-4.30 pm | 2020-09-08 | 25 | 5 | 20 | 5 | 20 | google meet | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Coupling interactions and orgel diagrams | 2020-09-07 | 13 | 10 | 90 | 10 | 90 | Lecture method using zoom meeting | Click Here |
Rohini P | English | 2nd bsc b1to b6 | The Beloved Charioteer | 2020-09-07 | 83 | 81 | 99 | 81 | 99 | Click Here | |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-09-07 | 50 | 21 | 42 | 21 | 42 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides Anacylin | 2020-09-07 | 13 | 6 | 46 | 6 | 46 | Zoom App screen sharing -Lecture method | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-09-07 | 50 | 33 | 66 | 33 | 66 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 2020-09-07 | 38 | 17 | 47 | 38 | 17 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology | 2020-09-07 | 28 | 11 | 45 | 11 | 45 | Google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Faraday laws | 2020-09-07 | 75 | 70 | 93 | 70 | 93 | Click Here | |
B Dorka | Biochemistry | III BSc Biochem | Proteins & Enzymes; Basic rules of replication | 2020-09-07 | 18 | 8 | 44.5 | 8 | 44.5 | Lecture Discussion through Google meet | Click Here |
Rohini | English | 2nd bsc b1to b6 | The Beloved Charioteer | 2020-09-07 | 91 | 90 | 99 | 90 | 99 | Click Here | |
U.Venkateswarlu | Zoology | M.Sc Final | Explanation of all physiological activities including Metabolism. Role of water in all the physiological activities in animals | 2020-09-07 | 25 | 8 | 32 | 8 | 32 | google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- Structure of chromosome | 2020-09-06 | 24 | 12 | 50 | 12 | 50 | Lecturer method using ppt through Zoom App | Click Here |
D. Vijaya Sree | Biochemistry | II, III B3, B4, B6 | small millets to a large population - guest lecture of GDC-Kukatpally | 2020-09-05 | 58 | 28 | 48 | 48 | 48 | zoom cloud meeting | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Vibrational frequency of phenols, esters and ethers | 2020-09-05 | 13 | 10 | 90 | 10 | 90 | Lecture method by zoom meeting | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vantillu | 2020-09-05 | 38 | 16 | 42.1 | 16 | 42.1 | Lecture method through zoom app | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Chromosomes notes given | 2020-09-05 | 38 | 28 | 73 | 28 | 73 | WhatsApp group | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-09-05 | 50 | 15 | 30 | 15 | 30 | Coscx WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean (less than series) | 2020-09-05 | 50 | 24 | 48 | 24 | 48 | Coscx WebEx meeting app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides jasmolin---2 | 2020-09-05 | 13 | 7 | 54 | 7 | 54 | Zoom App Screen share--lecture method | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Actinide contraction and comparision of Lanthandes and Actinides | 2020-09-05 | 67 | 38 | 56.7 | 38 | 56.7 | Cisco WebEx meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Problems | 2020-09-05 | 75 | 63 | 84 | 63 | 84 | Google classroom | Click Here |
D.Krishna Priya | Home science | I, II, III B. Sc | Article writing on role of proteins in immunity, strategies to combat food insecurity, holistic nutrition during covid | 2020-09-05 | 10 | 10 | 10 | 100 | 100 | Gmail | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Structure of the Nephron in detail Function of the kidney or Urine formation in fishes | 2020-09-05 | 25 | 12 | 48 | 12 | 48 | google meet | Click Here |
Dr. Venkateswara Rao Bodepudi | Hindi | Hindi III Semester | काव्यदीप - मातृभूमि - मैथिलीशरण गुप्त | 2020-09-04 | 69 | 15 | 22 | 14 | 93 | Jio meet https://jiomeetpro.jio.com/shortener?meetingId=2445754707 | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology- Structure of Chromosomes | 2020-09-04 | 38 | 20 | 52.63 | 20 | 52.63 | Lecturer method using PPt through Zoom App | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides jasmolin---1 | 2020-09-04 | 13 | 10 | 77 | 8 | 62 | Zoom app screensharing -- Lecture method Assignment --2 | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel deviations | 2020-09-04 | 38 | 24 | 65 | 24 | 65 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel deviations | 2020-09-04 | 28 | 13 | 47 | 13 | 47 | Google meet | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Vibrational frequency of alcohols ,acids and carbonyl compounds | 2020-09-04 | 13 | 10 | 90 | 10 | 90 | By lecture method through Zoom meeting | Click Here |
B Dorka | Biochemistry | III BSc Biochem | DNA ligase mechanism of Action | 2020-09-04 | 18 | 10 | 55.5 | 10 | 55.5 | Lecture Discussion through Google meet | Click Here |
G.sita | Electronics | III B.Sc | Introduction to AM | 2020-09-04 | 25 | 11 | 44 | 11 | 44 | Zoom app | Click Here |
D. Krishna Priya | Homescience | I, II, III B. sc | Nutrition guidelines for covid 19 patients, itks of foods during pandemic situation, lifestyle practices to fight with covid19 | 2020-09-04 | 10 | 10 | 100 | 100 | 100 | Gmail | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Structure of the kidney, various types of kidneys in fishes A brief discussion on Nephrons and their function. | 2020-09-04 | 25 | 10 | 40 | 10 | 40 | google meet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 2020-09-03 | 50 | 50 | 100 | 49 | 98 | Cisco Webex | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-09-03 | 50 | 22 | 44 | 22 | 44 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-09-03 | 50 | 24 | 48 | 24 | 48 | Coscx WebEx meeting app | Click Here |
K Aparna Seetharam | Chemistry | V semister final years | Remidial class on organic chemistry Hydrocarbons | 2020-09-03 | 120 | 57 | 49 | 57 | 49 | ICT zoom | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | amino acids | 2020-09-03 | 45 | 22 | 48.8 | 22 | 48.8 | zoom meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Applications of maxwells relations | 2020-09-03 | 77 | 35 | 45.45 | 35 | 45.46 | Ppt presentation webex app | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Telugu Bhasha | 2020-09-03 | 38 | 16 | 42.1 | 16 | 42.1 | Lecture method through Zoom app | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | iR spectroscopy | 2020-09-03 | 13 | 7 | 50 | 7 | 50 | by lecture method through zoom meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides CINERIN -2 | 2020-09-03 | 13 | 5 | 39 | 5 | 39 | ZOOMAPP screen sharing --Lecture method | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel deviations | 2020-09-03 | 38 | 23 | 60 | 23 | 60 | Google meet | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | f-block elements Sudents seminar | 2020-09-03 | 67 | 41 | 61.2 | 41 | 61.2 | Cisco WebEx Meet | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Andhramu putupoorvataralu | 2020-09-03 | 14 | 6 | 42.86 | 6 | 42.86 | Zoom meeting | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Problems | 2020-09-03 | 75 | 48 | 63 | 46 | 62 | Cisco WebEx problem solving | Click Here |
G.sita | Electronics | II B.Sc | Syllabus explained | 2020-09-03 | 30 | 10 | 33.3 | 10 | 33.3 | Zoom app | Click Here |
G.sita | Electronics | III B.Sc | Syllabus explained | 2020-09-03 | 25 | 13 | 52 | 13 | 53 | Zoom app | Click Here |
D. Krishna Priya | Home science | I, II, III B. Sc | Article writing on role of proteins in immunity, immune boosters in every day foods | 2020-09-03 | 10 | 10 | 10 | 10 | 100 | Zoom Gmail | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Excretory Organs in fishes ppt presented Excretory Organs Q & A (oral) | 2020-09-03 | 25 | 12 | 48 | 12 | 48 | google meet | Click Here |
Dr.G. Padmini Devi | Homescience | III B.Sc. H.Sc. | barriers in communication | 2020-09-02 | 23 | 17 | 73.91 | 17 | 73.91 | zoom | Click Here |
Anusha Karumuri | chemistry | B.Sc. IIIsem | carbonyl compounds | 2020-09-02 | 102 | 42 | 41 | 42 | 41 | googlemeet | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Andhramu putupoorvataralu | 2020-09-02 | 14 | 6 | 37.5 | 6 | 37.5 | Zoom meeting | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | types of peaks in ir spectra and characteristic vibrational frequencies of hydrocarbons | 2020-09-02 | 13 | 9 | 85 | 9 | 85 | zoom meeting by lecture method | Click Here |
B Dorka | Biochemistry | III BSc Biochem | MOLBIO DNA Polymerases | 2020-09-02 | 18 | 12 | 67 | 12 | 67 | Lecture Discussion through Google meet | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-09-02 | 50 | 20 | 40 | 20 | 40 | Coscx WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-09-02 | 50 | 30 | 60 | 30 | 60 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Maxwell's thermodynamic relations | 2020-09-02 | 77 | 36 | 46.7 | 36 | 46.7 | Ppt presentation via webex app | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | Southern and northern blotting techniques | 2020-09-02 | 36 | 14 | 38.88 | 11 | 30.55 | Google meet | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Telugu Bhasha | 2020-09-02 | 38 | 17 | 44.73 | 17 | 44.73 | Lecture method through Zoom app | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology exam through google form | 2020-09-02 | 38 | 15 | 47 | 15 | 47 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | viruses exam | 2020-09-02 | 28 | 12 | 47 | 12 | 47 | Google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Electric potential and equipotential surfaces | 2020-09-02 | 75 | 72 | 96 | 72 | 96 | Click Here | |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides Cinerin--1 | 2020-09-02 | 13 | 6 | 46 | 5 | 39 | ZOOM APP Screensharing--- Lecture method | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | f- block elements student seminar on Lanthanide contraction and its consequences | 2020-09-02 | 67 | 46 | 68.6 | 46 | 68.6 | Cisco WebEx meet | Click Here |
D. Vijaya Sree | Biochemistry | II B3, B4, B6 | analytical centrifugation | 2020-09-02 | 40 | 16 | 40 | 40 | 40 | zoom cloud meeting | Click Here |
J kavitha | Mathematics | V sem | Theorems on ideals | 2020-09-02 | 140 | 62 | 140 | 62 | 45 | Google meet | Click Here |
D. Krishna Priya | Homescience | I, II, III B. Sc | Article writing on role of water healthy body, ITKs of foods during pandemic situation | 2020-09-02 | 10 | 10 | 100 | 100 | 100 | Gmail | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Classification of lakes Evolution of Urino- genital System (Pro, Meso and Meta nephros) | 2020-09-02 | 25 | 12 | 48 | 12 | 48 | google meet | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-09-01 | 50 | 21 | 42 | 21 | 42 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-09-01 | 50 | 31 | 62 | 31 | 62 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Properties of DNA pol | 2020-09-01 | 18 | 9 | 50 | 9 | 50 | Lecture discussion through Google meet | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | PCR and its applications | 2020-09-01 | 36 | 17 | 47.2 | 14 | 38.8 | google meet | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Telugu Bhasha | 2020-09-01 | 38 | 14 | 36.84 | 14 | 36.84 | Lecture method through zoom app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring InsecticidesPYRETHRIN--2 | 2020-09-01 | 13 | 8 | 62 | 7 | 54 | ZOOM APP SCREEN SHARE----Lecture method | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | assignment on uv spectra | 2020-09-01 | 13 | 7 | 50 | 7 | 50 | zoom meeting and whatsapp | Click Here |
Anusha Karumuri | chemistry | B.Sc. IIIsem | carbonyl compounds | 2020-09-01 | 102 | 39 | 38 | 39 | 38 | googlemeet | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Andhramu putupoorvataralu | 2020-09-01 | 14 | 6 | 37.5 | 6 | 37.5 | Zoom meeting | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Electric potential and equipotential surfaces | 2020-09-01 | 75 | 44 | 58 | 42 | 56 | Cisco WebEx | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Student seminars on Lanthanide Electronic configuration and Oxidation states | 2020-09-01 | 67 | 41 | 61.2 | 41 | 61.2 | Cisco WebEx Meet | Click Here |
D. Krishna Priya | Homescience | III B. sc | Nutrition and immunity | 2020-09-01 | 10 | 8 | 80 | 80 | 80 | Gmail google Classroom | Click Here |
D. Krishna Priya | Homescience | II B.Sc &I B. sc | Article writing on strategies to combat food insecurity due to covid, immune boosters in every day foods | 2020-09-01 | 10 | 10 | 100 | 100 | 100 | Gmail | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Origin of Lakes | 2020-09-01 | 25 | 15 | 60 | 15 | 60 | Google Meet | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-31 | 50 | 18 | 36 | 18 | 36 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-31 | 50 | 39 | 78 | 39 | 78 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Replication - Overview | 2020-08-31 | 18 | 9 | 50 | 9 | 50 | Lecture - Discussion through Zoom | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Telugu Bhasha | 2020-08-31 | 38 | 17 | 44.73 | 17 | 44.73 | Lecture method through Zoom app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | praacheenaandhra padya saasanalu - Telugu basha sahityalu | 2020-08-31 | 13 | 12 | 90 | 12 | 90 | online class through zoom | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Maxwell's equations | 2020-08-31 | 77 | 25 | 32.4 | 24 | 31.16 | Webex app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | praacheenaandhra padya saasanalu - Telugu basha sahityalu | 2020-08-31 | 13 | 12 | 90 | 12 | 90 | online class through zoom | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides pyrethrolone | 2020-08-31 | 13 | 6 | 46 | 6 | 46 | zoomapp screen sharing ---Lecture method | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Applications of Gauss law | 2020-08-31 | 75 | 50 | 67 | 45 | 60 | Cisco WebEx | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | mock test on cinchonal alkaloids | 2020-08-31 | 13 | 9 | 70 | 9 | 70 | zoom meeting | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | assignment | 2020-08-31 | 13 | 11 | 85 | 11 | 85 | through whatsapp | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | About JKC-TCS iON skill course "Career Edge - Knockdown the Lockdown" subscription and accessing the content | 2020-08-31 | 67 | 37 | 55.2 | 37 | 55.2 | Cisco WebEx meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Video on Plasma membrane,Osmoregulatory mechanisms in fishes. | 2020-08-31 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Water pollution and diseases | 2020-08-31 | 25 | 10 | 40 | 10 | 40 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Water pollution and diseases | 2020-08-31 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Once upon a time_poem | 2020-08-30 | 35 | 19 | 54 | 19 | 100 | Zoom | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | praacheenaandhra padya saasanalu - Telugu basha sahityalu | 2020-08-30 | 13 | 12 | 90 | 12 | 90 | online class through zoom | Click Here |
J kavitha | Mathematics | V sem | Ideals | 2020-08-30 | 140 | 60 | 43 | 60 | 43 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Microbiological examination of water | 2020-08-30 | 25 | 11 | 44 | 11 | 44 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Water pollution and diseases | 2020-08-30 | 25 | 8 | 32 | 8 | 32 | Google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Proof of Gauss law | 2020-08-29 | 75 | 59 | 79 | 59 | 79 | Google classroom and whatsapp | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology- plasmamembrane structure & Functions | 2020-08-29 | 38 | 14 | 36.6 | 14 | 36.6 | Lecturer method using PPt through Zoom App | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | amino acids | 2020-08-29 | 55 | 14 | 25.45 | 14 | 25.45 | zoom meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Jkc TCSiON registration process | 2020-08-29 | 77 | 28 | 36.36 | 27 | 35.06 | Webex app screen sharing | Click Here |
Kuchipudi Sujatha | Chemistry | III BSC C2 | Trans Effect | 2020-08-29 | 24 | 5 | 20 | 5 | 20.3 | Zoom App | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | IR sestra vibrational frequency ,factors effecting vibrational frequency | 2020-08-29 | 13 | 7 | 50 | 7 | 50 | Zoom meeting | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | group discussion on metal carbonyls | 2020-08-29 | 28 | 10 | 35 | 10 | 35 | Zoom App | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | nucleus | 2020-08-29 | 34 | 19 | 55.8 | 18 | 52.9 | google meet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 2020-08-29 | 35 | 35 | 100 | 34 | 97 | Cisco Webex | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides | 2020-08-29 | 13 | 6 | 46 | 6 | 46 | Zoomapp through Screen sharing Lecture method | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Osmoregulation in fishes, Iso ,Hypo and Hypertonic solutions. | 2020-08-29 | 25 | 12 | 48 | 12 | 48 | Google Meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Biological investigation of water | 2020-08-29 | 25 | 11 | 44 | 11 | 44 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Dissolved oxygen | 2020-08-29 | 25 | 13 | 52 | 13 | 52 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Biological oxygen demand | 2020-08-29 | 25 | 11 | 44 | 11 | 44 | Google meet | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Once upon a time_poem | 2020-08-28 | 35 | 22 | 63 | 22 | 100 | Zoom | Click Here |
Anusha K | chemistry | B.Sc. IIIsem | carbonyl compounds haloform reaction | 2020-08-28 | 102 | 38 | 37 | 38 | 37 | googlemeet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 2020-08-28 | 42 | 42 | 100 | 41 | 98 | Cisco Webex | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Telugu Bhasha | 2020-08-28 | 38 | 16 | 42.1 | 16 | 42.1 | Lecture method through Zoom app | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | Mitochondria | 2020-08-28 | 34 | 21 | 61.76 | 18 | 52.94 | Google meet | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | EAN Rule and Ni(CO)4 Structure | 2020-08-28 | 28 | 10 | 35 | 10 | 35 | ZOOM APP | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | iR spectroscopy | 2020-08-28 | 13 | 7 | 50 | 7 | 50 | zoom meeting | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-28 | 50 | 31 | 62 | 31 | 62 | Coscx WebEx meeting app | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-28 | 50 | 27 | 54 | 27 | 54 | Coscx WebEx meeting app | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Plasmamembrane Structure-Models | 2020-08-28 | 28 | 12 | 42.86 | 12 | 42.86 | Lecturer method using ppt through Zoom app | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Telugu Bhashaa | 2020-08-28 | 14 | 6 | 37.5 | 6 | 37.5 | Zoom Class | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Naturally occuring Insecticides | 2020-08-28 | 13 | 5 | 39 | 5 | 39 | Lecture Method Using ZOOM App | Click Here |
Dr. K. Sujatha | Telugu | III B. A | Balavyakaranam-sangnaparichhedam | 2020-08-28 | 14 | 7 | 50 | 7 | 50 | Zoom online class | Click Here |
Dr. K. Sujatha | Telugu | II B. Sc | Vaamanavatharam | 2020-08-28 | 58 | 28 | 48 | 28 | 48 | Zoom online class | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Gauss law proof | 2020-08-28 | 75 | 35 | 47 | 35 | 47 | Cisco WebEx | Click Here |
J.Kavitha | Mathematics | V sem | Problems on field and subring | 2020-08-28 | 145 | 70 | 48 | 70 | 48 | Google meet | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | metalloporphyrins and biological imp of metals | 2020-08-28 | 55 | 14 | 26 | 12 | 22 | zoom meet | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | praangnannaya yugamu nandali praacheena saasanalloni Andhra basha saaraswathamulu | 2020-08-28 | 13 | 12 | 90 | 12 | 90 | online class through zoom | Click Here |
Dr. Venkateswara Rao Bodepudi | Hindi | Hindi III Semester | काव्यदीप - तुलसी के दोहे | 2020-08-28 | 69 | 20 | 29 | 20 | 100 | Cisco Webex https://meetingsapac16.webex.com/meetingsapac16/j.php?MTID=m843e2ce4ac97271a3d1a6624d4668f7d | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Test Conducted and Brief Introduction to Osmoregulation. | 2020-08-28 | 25 | 13 | 52 | 13 | 52 | Google Meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Chemical characterization of water | 2020-08-28 | 25 | 10 | 40 | 10 | 40 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Minor elements of water | 2020-08-28 | 25 | 10 | 40 | 10 | 40 | Google meet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 2020-08-27 | 45 | 45 | 100 | 41 | 91 | Webex | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-27 | 50 | 26 | 52 | 26 | 52 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-27 | 50 | 38 | 76 | 38 | 76 | Coscx WebEx meeting app | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | metalloporphyrins | 2020-08-27 | 55 | 24 | 43.6 | 24 | 43.6 | zoom meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Maxwell's thermodynamic equations | 2020-08-27 | 77 | 36 | 46.75 | 35 | 45.45 | Webex app | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | carbonyl compounds cannizaro reaction | 2020-08-27 | 102 | 34 | 33 | 34 | 33 | googlemeet | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | Metal Carbonyls | 2020-08-27 | 28 | 6 | 21.4 | 6 | 21.4 | Zoom App | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vaamanaavathaaramu | 2020-08-27 | 38 | 13 | 34.21 | 13 | 34.21 | Lecture method through Zoom app | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | structural elucidation and synthesis of berberine | 2020-08-27 | 13 | 7 | 50 | 7 | 50 | zom meeting | Click Here |
Dr. K. Sujatha | Telugu | II B. Sc | Vaamanavatharam | 2020-08-27 | 58 | 28 | 48 | 28 | 48 | Zoom online class | Click Here |
Dr. K. Sujatha | Telugu | II B. Sc | Vaamanavatharam | 2020-08-27 | 58 | 28 | 48 | 28 | 48 | Zoom online class | Click Here |
Dr. K. Sujatha | Telugu | III B. A | Balavyakaranam-sangnaparichhedam | 2020-08-27 | 14 | 7 | 50 | 7 | 50 | Zoom online class | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Telugu Bhashaa charitra introduction class | 2020-08-27 | 14 | 6 | 37.5 | 6 | 37.5 | Zoom Class | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Phenothiazines Chemical reactions& Pharmacology | 2020-08-27 | 13 | 5 | 39 | 5 | 39 | zoom app screen sharing Lecture method | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 2020-08-27 | 28 | 13 | 47 | 13 | 47 | Google meet lecture method with ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel laws | 2020-08-27 | 38 | 24 | 63 | 24 | 63 | Google meet lecture method with ppt | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Doubts Clarification | 2020-08-27 | 60 | 35 | 58.3 | 35 | 58.3 | Cisco WebEx | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Practical.. DeMorgan laws | 2020-08-27 | 75 | 45 | 60 | 44 | 58 | Cisco WebEx | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | praangnannaya yugamu nandali praacheena saasanalloni Andhra basha saaraswathamulu | 2020-08-27 | 13 | 12 | 90 | 12 | 90 | online video class through zoom | Click Here |
Dr. Venkateswara Rao Bodepudi | Hindi | Hindi III Semester | काव्यदीप - कबीर के दोहे | 2020-08-27 | 69 | 16 | 23 | 23 | 100 | Cisco Webex https://meetingsapac16.webex.com/meetingsapac16/j.php?MTID=mf40b7ea307e9f6810c5cd03e88f9e222 | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Major lakes and Major rivers in India. | 2020-08-27 | 25 | 18 | 72 | 18 | 72 | Google Meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Physical characterization of water | 2020-08-27 | 25 | 12 | 48 | 12 | 48 | Google meet | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Praangnannaya yugamunandali Andhra Basha sahitya viseshalu | 2020-08-26 | 13 | 10 | 90 | 10 | 90 | Online class through zoom | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Quiz | 2020-08-26 | 60 | 41 | 68.3 | 41 | 68.3 | Cisco Webex and Google forms | Click Here |
S J M PRATHAP KUMAR | Zoology | III MZC BiZC | Layers management | 2020-08-26 | 30 | 15 | 50 | 15 | 50 | Lecture method PowerPoint presentation shared in Google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- structure of plasma membrane | 2020-08-26 | 15 | 24 | 62.5 | 15 | 62.5 | Lecturer method using Plasmamembrane ppt through Zoom app | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Shyness,Myshield | 2020-08-26 | 35 | 14 | 49 | 14 | 100 | Zoom | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Electric and magnetic flux | 2020-08-26 | 75 | 40 | 56 | 40 | 56 | Cisco WebEx | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Accessory respiratory organs,Major lakes and rivers in India. | 2020-08-26 | 25 | 14 | 56 | 14 | 56 | Google Meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Beneficial role of microorganisms in fermentation | 2020-08-26 | 25 | 13 | 52 | 13 | 52 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Manufacture of alcoholic beverages | 2020-08-26 | 25 | 15 | 60 | 15 | 60 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Chromosomes | 2020-08-26 | 28 | 13 | 46 | 13 | 46 | Google meet lecture method with ppt | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-26 | 50 | 24 | 48 | 24 | 48 | Material send to whatsapp group and WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-26 | 50 | 37 | 74 | 37 | 74 | WebEx meeting app | Click Here |
Dr. K. Sujatha | Telugu | III B. A | Balavyakaranam-sangnaparichhedam | 2020-08-26 | 14 | 7 | 50 | 7 | 50 | Zoom online class | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Information about spoken tutorials | 2020-08-26 | 77 | 37 | 48.05 | 37 | 48.05 | Webex app | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | carbonyl compounds | 2020-08-26 | 102 | 38 | 37 | 37 | 36 | googlemeet | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | Gene transfer methods | 2020-08-26 | 36 | 12 | 33.33 | 11 | 30.55 | Google meet | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Structure and synthesis of Narcotine | 2020-08-26 | 13 | 7 | 50 | 7 | 50 | Zoom meeting | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vaamanaavathaaramu | 2020-08-26 | 38 | 18 | 47.36 | 18 | 47.36 | Lecture method through Zoom app | Click Here |
Rohini P | English | 2nd bsc b1to b6 | Once Upon A Time poem | 2020-08-26 | 81 | 40 | 48 | 40 | 48 | Google Meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Phenothiazines synthesis | 2020-08-26 | 13 | 7 | 54 | 7 | 54 | zoom app lecture method through screen sharing assignment--1 | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Andhravaangmaya charithra - yuga vibajana | 2020-08-25 | 13 | 10 | 90 | 10 | 90 | Online class through zoom | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology- plasmamembrane structure | 2020-08-25 | 38 | 20 | 52.63 | 20 | 52.63 | Lecturer method using ppt through Zoom App | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | Metal Carbonyls | 2020-08-25 | 28 | 14 | 50 | 14 | 50 | Whats app | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Structure and Function of the gills in fishes | 2020-08-25 | 25 | 15 | 60 | 15 | 60 | Google Meet | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Polymerase chain reaction | 2020-08-25 | 29 | 18 | 62.06 | 18 | 62.06 | zoom screen sharing-video play | Click Here |
M PADMAJA | Political Science | III BA | Notes given | 2020-08-25 | 45 | 13 | 28.89 | 13 | 28.89 | Notes given | Click Here |
M PADMAJA | Political Science | II BA | Minto Marle reforms | 2020-08-25 | 34 | 18 | 52 | 18 | 52 | Lecture through webex app | Click Here |
S J M PRATHAP KUMAR | Zoology | III MZC BiZC | Growers management | 2020-08-25 | 30 | 19 | 63.33 | 19 | 63.33 | Lecture method PowerPoint presentation shared Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology, viruses | 2020-08-25 | 28 | 13 | 55 | 13 | 55 | Material shared through WhatsApp and doubts clarified | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Different types of pollutions | 2020-08-25 | 25 | 17 | 68 | 17 | 68 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 2020-08-25 | 38 | 24 | 65 | 24 | 65 | Google meet lecture method with ppt | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | structural elucidation and synthesis of dicentrine | 2020-08-25 | 13 | 8 | 85 | 8 | 85 | zoom meeting | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Water pollution and analysis | 2020-08-25 | 25 | 13 | 52 | 13 | 52 | Google meet | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vaamanaavathaaramu | 2020-08-25 | 32 | 23 | 71.87 | 23 | 71.87 | Lecture method through Zoom app | Click Here |
Rohini P | English | 2nd bsc b1to b6 | Once Upon A Time poem | 2020-08-25 | 81 | 72 | 88 | 72 | 88 | Video link | Click Here |
Dr. K. Sujatha | Telugu | III B. A | Balavyakaranam-sangnaparichhedam | 2020-08-25 | 14 | 4 | 28.6 | 4 | 28.6 | Zoom online class | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Phenothiazines synthesis | 2020-08-25 | 13 | 5 | 39 | 5 | 39 | zoomapp screen sharing | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Metal Carbonyls | 2020-08-25 | 60 | 38 | 63.3 | 38 | 63.3 | Cisco Webex | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-25 | 50 | 17 | 34 | 17 | 34 | Material send to whatsapp group and WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-25 | 50 | 40 | 80 | 40 | 80 | Material send to whatsapp group and WebEx meeting app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Vaangmyamu-saaraswathamu-Saahithyamu vivarana | 2020-08-24 | 13 | 10 | 90 | 10 | 90 | Online class through zoom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-08-24 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Lentic, Lotic habitats, Videos on gill respiration | 2020-08-24 | 25 | 15 | 60 | 15 | 60 | Google Meet | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-24 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 2020-08-24 | 28 | 11 | 39 | 11 | 39 | Google meet lecture method with ppt | Click Here |
J.Kavitha | Mathematics | V sem | Theorem and problems on fields | 2020-08-24 | 144 | 76 | 53 | 76 | 53 | Google meet | Click Here |
Dr.G. Padmini Devi | Homescience | III B.Sc. H.Sc. | elements of communication | 2020-08-24 | 23 | 19 | 82.16 | 19 | 82.16 | zoom | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | structural elucidation and synthesis of cinchonine | 2020-08-24 | 13 | 8 | 85 | 8 | 85 | through zoom meeting by lecture method | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- Fine structure of Cell wall | 2020-08-24 | 28 | 14 | 50 | 14 | 50 | Lecturer method with the help of PPt through Zoom App | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Gibbs free energy Enthalpy | 2020-08-24 | 77 | 37 | 48 | 34 | 44.1 | Webex app Shared material in Google Classroom | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | carbonyl compounds | 2020-08-24 | 102 | 37 | 36 | 37 | 36 | googlemeet | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vaamanaavathaaramu | 2020-08-24 | 32 | 18 | 56.25 | 18 | 56.25 | lecture method through zoom app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Phenothiazines Classification,Methods of preparation | 2020-08-24 | 13 | 6 | 46 | 6 | 46 | Lecture method,Zoom app screen sharing | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-24 | 50 | 20 | 40 | 20 | 40 | WebEx meeting app online class and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-24 | 50 | 37 | 74 | 37 | 74 | WebEx meeting app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | Metal Carbonyls | 2020-08-24 | 60 | 42 | 70 | 42 | 70 | Cisco Webex | Click Here |
A. Sravani | Cost accounting | III B. Com | Introduce | 2020-08-24 | 50 | 20 | 40 | 20 | 40 | WhatsApp video call | Click Here |
M PADMAJA | Political Science | III BA | Features of ancient Indian Political Thought | 2020-08-24 | 45 | 18 | 40 | 18 | 40 | Lecture | Click Here |
M PADMAJA | Political Science | II BA | Introduction to Minto Marle reforms | 2020-08-24 | 34 | 18 | 52.94 | 18 | 52.94 | Lecture through webex app | Click Here |
S J M PRATHAP KUMAR | Zoology | III MZC BiZC | Intensive system in poultry | 2020-08-24 | 30 | 15 | 50 | 15 | 50 | Lecture method PowerPoint presentation shared Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Introduction of bacterial, viral diseases | 2020-08-24 | 25 | 10 | 40 | 10 | 40 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Introduction of fungal and protozoa diseases | 2020-08-24 | 25 | 15 | 60 | 15 | 60 | Google meet | Click Here |
Rohini P | English | 2nd bsc b1to b6 | Once Upon A Time poem | 2020-08-24 | 81 | 72 | 88 | 72 | 88 | Click Here | |
Naga Prasanna. M | Zoology | III MZC & BiZC | Cosmids, BAC, YAC | 2020-08-24 | 36 | 14 | 36 | 12 | 33.33 | Google meet | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-08-23 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-23 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
J.Kavitha | Mathematics | V sem | Theorems on fields | 2020-08-23 | 144 | 52 | 36 | 52 | 36 | Google meet | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-08-22 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Limnology as an applied Science,Inland water types | 2020-08-22 | 25 | 8 | 30 | 8 | 30 | Google Meet | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-22 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | Lysosomes | 2020-08-22 | 34 | 16 | 47.05 | 14 | 41.17 | google meet | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Telugu Sahitya charithra | 2020-08-22 | 13 | 10 | 90 | 10 | 90 | Online class through zoom | Click Here |
Dr. Venkateswara Rao Bodepudi | Hindi | Hindi III Semester | Hindi Syllabus & Model Paper | 2020-08-21 | 69 | 16 | 23 | 16 | 100 | https://meetingsapac40.webex.com/meetingsapac40/j.php?MTID=m3771c4a605b8eafd1363d14af201008e | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 2020-08-21 | 38 | 27 | 77 | 27 | 77 | Video lesson shared n doubts clarified through WhatsApp group | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Classification of fishes,Limnology introduction | 2020-08-21 | 25 | 15 | 60 | 15 | 60 | Google Meet | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | synthsis of quinine | 2020-08-21 | 13 | 7 | 50 | 7 | 50 | zoom meeting | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Note Making _practice | 2020-08-21 | 75 | 13 | 17 | 13 | 100 | Zoom App | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Theories of Bonding in Metals | 2020-08-21 | 61 | 44 | 72.1 | 44 | 72.1 | Cisco WebEx | Click Here |
Kuchipudi Sujatha | Chemistry | V SEM | Reactivity of metal complexes | 2020-08-21 | 24 | 5 | 20 | 5 | 20 | ZOOM APP | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Meselson-Stahl Experiment | 2020-08-21 | 18 | 12 | 67 | 12 | 67 | Zoom whiteboard - Lecture Discussion | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | golgi complex | 2020-08-21 | 34 | 15 | 44.11 | 14 | 41.17 | Google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology-The Cell Wall | 2020-08-21 | 24 | 16 | 66.67 | 16 | 66.67 | Lecturer method with ppt on Cell wall through Zoom app | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | test on photochemistry | 2020-08-21 | 55 | 27 | 49 | 27 | 49 | whats app and google class room | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Gene transfer techniques -Natural methods | 2020-08-21 | 29 | 19 | 65.51 | 19 | 65.51 | Lecture method Zoom screen sharing | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel laws | 2020-08-21 | 38 | 24 | 65 | 24 | 65 | Google meet lecture method with ppt. | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 2020-08-21 | 48 | 48 | 100 | 47 | 98 | Zoom app | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 2020-08-21 | 28 | 13 | 47 | 13 | 47 | Google meet lecture method with ppt | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Techniques to determine mechanism of a Chemical Reaction | 2020-08-21 | 13 | 6 | 46 | 6 | 46 | Lecture method by ZOOM App | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Revision | 2020-08-21 | 75 | 35 | 46 | 35 | 46 | Cisco WebEx | Click Here |
M PADMAJA | Political Science | III BA | Salient features of ancient Indian Political Thought | 2020-08-21 | 45 | 17 | 37.77 | 17 | 37.77 | Lesson through webex app | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Advanced techniques in immunology | 2020-08-21 | 25 | 13 | 52 | 13 | 52 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Different types of immunological tests | 2020-08-21 | 25 | 14 | 56 | 14 | 56 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Versatile techniques in immunology | 2020-08-21 | 25 | 15 | 60 | 15 | 60 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Polymerases properties and functions | 2020-08-20 | 25 | 11 | 44 | 11 | 44 | Google meet | Click Here |
D. Vijaya Sree | Biochemistry | III B4,B6 | antibodies structure | 2020-08-20 | 16 | 11 | 69 | 69 | 69 | Zoom cloud meeting | Click Here |
Dr. Venkateswara Rao Bodepudi | Hindi | Hindi III Semester | Hindi Syllabus & Model Paper | 2020-08-20 | 69 | 11 | 16 | 11 | 100 | Zoom https://us04web.zoom.us/j/71680776036?pwd=RzNLQ0RveW1xbVRJV2ZOaE1zSXVOdz09 | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | Structural elucidation of Quinine | 2020-08-20 | 13 | 9 | 70 | 9 | 70 | Through zoom meetng | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | Halogen compounds | 2020-08-20 | 102 | 32 | 31 | 32 | 31 | googlemeet | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Gene transfer techniques | 2020-08-20 | 29 | 19 | 65.51 | 19 | 65.51 | zoom screen sharing | Click Here |
J kavitha | Mathematics | V sem | Cancillation laws,integraldomain &field | 2020-08-20 | 144 | 60 | 42 | 60 | 42 | Google meet | Click Here |
Kuchipudi Sujatha | Chemistry | V SEM | REACTIVITY OF METALS | 2020-08-20 | 24 | 5 | 20 | 5 | 20 | ZOOM APP | Click Here |
SHAIK JUBEDA | PHYSICS | II BSC MPC & MPCS | THERMODYNAMIC POTENTIALS | 2020-08-20 | 77 | 35 | 45.45 | 8 | 10.38 | webex app | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Metal Carbonyls | 2020-08-20 | 60 | 44 | 73.3 | 44 | 73.3 | Cisco WebEx meet | Click Here |
U.Venkateswarlu | Zoology | M.Sc Final | Introduction to Limnology and Ichthyology | 2020-08-20 | 25 | 14 | 56 | 14 | 56 | Google meet | Click Here |
Dr. g.padmini devi | Homescience | III B.Sc. H.sc | models of communication | 2020-08-20 | 23 | 17 | 73 | 17 | 73 | zoom | Click Here |
M.Indiramma | English | IIBSc _A6,A7,A8 | Note Making | 2020-08-20 | 13 | 12 | 98 | 12 | 100 | Zoom | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-20 | 50 | 22 | 44 | 22 | 44 | Coscx WebEx meeting app | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-20 | 50 | 31 | 62 | 31 | 62 | Coscx WebEx meeting app | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 2020-08-20 | 40 | 40 | 100 | 39 | 98 | Zoom app | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology- Fine structure of Cell wall | 2020-08-20 | 38 | 12 | 31.58 | 12 | 31.58 | Lectureell method using ppt on Cell wall through Zoom app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Techniques to determine mechanism of a Chemical Reaction | 2020-08-20 | 13 | 6 | 46 | 6 | 46 | zoom app screen sharing | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Quiz on logic gates | 2020-08-20 | 57 | 26 | 43 | 26 | 43 | Google classroom quiz | Click Here |
S J M PRATHAP KUMAR | Zoology | III YEAR B2,B4 | Poultry house systems | 2020-08-20 | 30 | 12 | 40 | 12 | 40 | Lecture method PowerPoint presentation shared Google meet | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | bio inorganic chemistry | 2020-08-20 | 55 | 30 | 54.5 | 30 | 54.5 | zoom meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Polymerases properties and functions | 2020-08-20 | 25 | 11 | 44 | 11 | 44 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Reverse transcriptase properties and functions | 2020-08-20 | 25 | 12 | 48 | 12 | 48 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | PBR 322 and its derivatives | 2020-08-20 | 25 | 11 | 44 | 11 | 44 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | DNA ligases properties and functions | 2020-08-19 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Nucleases properties and functions | 2020-08-19 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Types of restriction endonucleases | 2020-08-19 | 25 | 8 | 32 | 8 | 32 | Google meet | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | cloning vectors-plasmids | 2020-08-19 | 29 | 19 | 65.51 | 19 | 65.51 | Lecture method -ZOOM- ppt screen sharing | Click Here |
J.Kavitha | Mathematics | V sem | Zero divisors of ring | 2020-08-19 | 145 | 76 | 52 | 76 | 52 | Google meet | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | photo physical processes | 2020-08-19 | 55 | 27 | 49 | 27 | 49 | zoom meet | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Alkaloids | 2020-08-19 | 13 | 5 | 40 | 5 | 40 | Zoom meeting | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Metal Carbonyls | 2020-08-19 | 60 | 41 | 68.3 | 41 | 68.3 | Cisco WebEx meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Entropy | 2020-08-19 | 77 | 39 | 50.64 | 39 | 50.64 | Webex app | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | bacteriophage vectors | 2020-08-19 | 36 | 17 | 50 | 17 | 50 | Google meet | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vaamanaavathaaramu | 2020-08-19 | 32 | 16 | 50 | 16 | 50 | Lecture method through Zoom app | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-19 | 50 | 16 | 32 | 16 | 32 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Arithmetic mean | 2020-08-19 | 50 | 34 | 68 | 34 | 68 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M PADMAJA | Political Science | II BA | Salient features of the Indian constitution | 2020-08-19 | 48 | 32 | 66.67 | 32 | 66.67 | Study material given through whatsapp | Click Here |
M PADMAJA | Political Science | III BA | Ancient Indian Political Thought | 2020-08-19 | 45 | 16 | 35.55 | 16 | 35.55 | Lesson through webex | Click Here |
Rohini | English | 2nd bsc b1to b6 | Shyness My Shield questions | 2020-08-19 | 81 | 72 | 88 | 72 | 88 | What's app | Click Here |
S J M PRATHAP KUMAR | Zoology | III YEAR B2,B4 | Poultry house construction | 2020-08-19 | 30 | 10 | 33.33 | 10 | 33.33 | Power point presentation shred Google meet | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Techniques to determine mechanism of a Chemical Reaction | 2020-08-19 | 13 | 4 | 31 | 4 | 31 | Lecture method --- ZOOM app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Logic gates practical | 2020-08-19 | 75 | 34 | 44 | 34 | 44 | Cisco WebEx, recorded video | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 2020-08-19 | 28 | 10 | 35 | 10 | 35 | Lecture method ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology | 2020-08-19 | 38 | 24 | 65 | 24 | 65 | WhatsApp group discussion material shared | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Student details in APCCE - info | 2020-08-19 | 18 | 14 | 78 | 14 | 78 | Zoom | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Types of restriction endonucleases | 2020-08-19 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | DNA ligases properties and functions | 2020-08-19 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Nucleases properties and functions | 2020-08-19 | 25 | 8 | 32 | 8 | 32 | Google meet | Click Here |
M PADMAJA | Political Science | II BA | National Movement | 2020-08-18 | 48 | 20 | 41.6 | 20 | 41.6 | Webex | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | Halogen compounds | 2020-08-18 | 102 | 30 | 29 | 30 | 29 | lecture through google meet | Click Here |
Dr. g.padmini devi | Homescience | III B.Sc. H.sc | process of communication | 2020-08-18 | 23 | 18 | 78.2 | 18 | 78.2 | zoom | Click Here |
J.Kavitha | Mathematics | V sem | Boolean rings | 2020-08-18 | 144 | 85 | 59 | 85 | 59 | Google meet | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | Ord | 2020-08-18 | 13 | 7 | 50 | 7 | 50 | zoom meeting | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | cell Biology - Nucleus | 2020-08-18 | 38 | 14 | 36.84 | 14 | 36.84 | Lecturer method using ppt on Cell Biology- The Nucleus through Zoom App | Click Here |
B Dorka | Biochemistry | III BSc Biochem | Molecular Biology Models of Replication | 2020-08-18 | 18 | 14 | 78 | 14 | 78 | Zoom Board; Lecture-Discussion | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 2020-08-18 | 38 | 24 | 65 | 24 | 65 | Google meet ppt | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Vaamanaavathaaramu | 2020-08-18 | 32 | 13 | 40.6 | 13 | 40.6 | Lecture method through Zoom app | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | vectors - pbr and puc | 2020-08-18 | 36 | 20 | 55.55 | 17 | 47.22 | google meet | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet overheads | 2020-08-18 | 50 | 17 | 34 | 17 | 34 | Coscx WebEx meeting app and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Business statistics introduction | 2020-08-18 | 50 | 34 | 68 | 34 | 68 | Coscx WebEx meeting app | Click Here |
M PADMAJA | Political Science | III BA | Sources of Indian Political Thought | 2020-08-18 | 35 | 14 | 40 | 14 | 40 | Lecture through webex app | Click Here |
Rohini | English | 2nd bsc b1to b6 | Shyness My Shield | 2020-08-18 | 81 | 81 | 100 | 81 | 100 | What's app | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology material | 2020-08-18 | 28 | 22 | 78 | 22 | 78 | WhatsApp group | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology material | 2020-08-18 | 28 | 22 | 78 | 22 | 78 | WhatsApp group | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Half adder & full adder | 2020-08-18 | 75 | 45 | 60 | 45 | 60 | Cisco WebEx | Click Here |
Kuchipudi Sujatha | Chemistry | III BSC C2 | group discussion in d block elements | 2020-08-18 | 30 | 7 | 23.3 | 7 | 23.3 | group discussion by lecture method | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Theories of Bonding in Metals | 2020-08-18 | 60 | 38 | 63.3 | 38 | 63.3 | Cisco WebEx | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Examples of Multistep process Rearrangements & Mechanisms | 2020-08-18 | 13 | 6 | 46 | 6 | 46 | Lecture method by ZOOM app | Click Here |
S J M PRATHAP KUMAR | Zoology | III YEAR B2,B4 | Types of chickens | 2020-08-18 | 30 | 18 | 60 | 18 | 60 | Lecture method PowerPoint presentation Google meet | Click Here |
S J M PRATHAP KUMAR | Zoology | III YEAR B2,B4 | Types of chickens | 2020-08-18 | 30 | 18 | 60 | 18 | 60 | Lecture method PowerPoint presentation Google meet sharing | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | Introduction to C | 2020-08-18 | 36 | 36 | 100 | 100 | 100 | Whats app Group | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Alkaloids | 2020-08-18 | 13 | 5 | 40 | 5 | 40 | Zoom meeting | Click Here |
B.Vijaya rekha | Zoology | II M.Sc | Tools and techniques used in genetic engineering | 2020-08-17 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Introduction about restriction endonucleases | 2020-08-17 | 25 | 13 | 52 | 13 | 52 | Google meet | Click Here |
J kavitha | Mathematics | V sem | Ring def ,examples and theorems | 2020-08-17 | 140 | 77 | 55 | 77 | 55 | Google meet | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Optical rotatory dispersion | 2020-08-17 | 13 | 7 | 50 | 7 | 50 | Zoom meeting | Click Here |
M PADMAJA | Political Science | III BA | Ancient Indian Political Thought | 2020-08-17 | 54 | 14 | 25.92 | 14 | 25.92 | Lecture method through Cisco WebEx | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | CARNOT ENGINE problems | 2020-08-17 | 77 | 36 | 46.7 | 36 | 46.7 | Webex app | Click Here |
Dorka | Biochemistry | III BSc Biochem | Hershey & Chase Experiment | 2020-08-17 | 18 | 15 | 83 | 15 | 83 | Zoom -Whiteboard, Lecture-Discussion | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Chandassu | 2020-08-17 | 32 | 14 | 43.75 | 14 | 43.75 | Lecture method through Zoom app using PPT | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | Restriction enzymes, types and applications | 2020-08-17 | 36 | 16 | 44.44 | 36 | 44.44 | google meet | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | Theories of Bonding in Metals | 2020-08-17 | 62 | 41 | 66.1 | 41 | 66.1 | Cisco Webex and Google classroom | Click Here |
M venkataramana | Commerce | III bcom general | Performa of Cost sheet | 2020-08-17 | 50 | 19 | 38 | 19 | 38 | WebEx meeting | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Types of averages | 2020-08-17 | 50 | 28 | 56 | 28 | 56 | WebEx meeting | Click Here |
G V Bhaskar | Mathematics | 3 Semester | Groups | 2020-08-17 | 50 | 46 | 92 | 46 | 92 | Cisco Webex Video app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Examples of Multistep process Rearrangements& Mechanisms | 2020-08-17 | 13 | 7 | 54 | 7 | 54 | Lecture Method by ZOOM App | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | cell Biology - Nucleus | 2020-08-17 | 24 | 12 | 50 | 12 | 50 | Lecturer method through Zoom meeting using ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 2020-08-17 | 38 | 18 | 45 | 18 | 45 | Google meet ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Genetics | 2020-08-17 | 28 | 8 | 25 | 8 | 25 | Google meet ppt | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | De Morgan's laws | 2020-08-17 | 75 | 45 | 60 | 45 | 60 | Cisco WebEx | Click Here |
Rohini | English | 2nd bsc b1to b6 | Shyness My Shield | 2020-08-17 | 81 | 72 | 90 | 72 | 90 | Google Meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Tools and techniques used in genetic engineering | 2020-08-17 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Introduction about restriction endonucleases | 2020-08-17 | 25 | 13 | 52 | 13 | 52 | Google meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamics numerical problems | 2020-08-16 | 77 | 25 | 32.4 | 25 | 32.4 | Webex app | Click Here |
G V Bhaskar | Mathematics | 3 Semester | Groups | 2020-08-16 | 25 | 18 | 72 | 18 | 72 | Cisco Webex Video app | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-08-16 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | mock test 1 in uv spectroscopy | 2020-08-15 | 13 | 10 | 85 | 10 | 85 | zoom meeting | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | specialised structures of plasma membrane and endoplasmic reticulum | 2020-08-15 | 34 | 12 | 35.29 | 12 | 35.29 | google meet | Click Here |
B.Sucharitha | Chemistry | M.Sc;ll year | Methods to determine reaction mechanism of free radicals- chemical kinetics | 2020-08-15 | 13 | 4 | 31 | 4 | 31 | Zoom app | Click Here |
D. Vijaya Sree | Biochemistry | III B4, B6 | immune response | 2020-08-15 | 18 | 13 | 72 | 72 | 72 | zoom meeting | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Carnot theorem | 2020-08-14 | 77 | 22 | 28.5 | 22 | 28.5 | Webex app | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | Halogen compounds | 2020-08-14 | 27 | 102 | 26 | 27 | 26 | lecture through google meet | Click Here |
Dr.G. Padmini Devi | Homescience | III B.Sc. H.Sc. | communication | 2020-08-14 | 24 | 18 | 75 | 18 | 75 | zoom meeting | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY | II B.A (III sem) | introduction of kakatiyas | 2020-08-14 | 54 | 26 | 48 | 26 | 48 | online class taken through zoom app | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | D Block Elements | 2020-08-14 | 30 | 4 | 13 | 4 | 13 | lecture method by using zoom app | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- Cell Organells | 2020-08-14 | 24 | 16 | 66.67 | 16 | 66.67 | Zoom App -Lecturer method- Material issued through whats app group | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Chandassu | 2020-08-14 | 32 | 12 | 37.5 | 12 | 37.5 | Lecture method through Zoom app using PPT | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | Functions of plasma membrane, Transport through plasma membrane, cell junctions | 2020-08-14 | 34 | 15 | 44.11 | 15 | 44.11 | Google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Logic circuits | 2020-08-14 | 75 | 55 | 73 | 55 | 73 | Google classroom | Click Here |
B. Sucharitha | Chemistry | M.Sc II Year | Methods to determine Reaction Mechanism of Free Radicals | 2020-08-14 | 13 | 4 | 31 | 4 | 31 | Lecture Method by ZOOM App | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Theories of Bonding in Metals | 2020-08-14 | 54 | 38 | 70.4 | 38 | 70.4 | Cisco Webex meeting | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | Absorption maxima of aromatic compouds | 2020-08-14 | 13 | 5 | 40 | 5 | 40 | Lecture- Discussion with board in Zoom class | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | Halogen compounds | 2020-08-13 | 102 | 32 | 31 | 32 | 31 | lecture | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | Ultraviolet Spectroscopy | 2020-08-13 | 13 | 7 | 50 | 7 | 50 | Ultraviolet Spectroscopy – Sample Problems in aromatic compounds Using Woodward-Fieser Rules | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | Theories of Bonding in Metals | 2020-08-13 | 52 | 34 | 65.4 | 34 | 65.4 | Cisco webex | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | Plasma membrane - various models of plasma membrane | 2020-08-13 | 34 | 19 | 55.88 | 18 | 52.94 | GOOGLE MEET | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Chandassu | 2020-08-13 | 32 | 10 | 31.25 | 10 | 31.25 | Lecture method through Zoom app using PPT | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Second law of thermodynamics | 2020-08-13 | 77 | 26 | 33.7 | 26 | 33.7 | Webex app | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | D Block Elements | 2020-08-13 | 31 | 6 | 20 | 6 | 20 | Lecture Method By using zoon app | Click Here |
Kuchipudi Sujatha | Chemistry | III BSC C2 | Bio In Organic elements | 2020-08-13 | 24 | 14 | 58 | 14 | 58 | material shared with whatsapp | Click Here |
B.Sucharitha | Chemistry | M.Sc. chemistry IIYear | Free radical reactions and mechanism | 2020-08-13 | 13 | 5 | 40 | 5 | 40 | Through zoom meeting | Click Here |
Dorka | Biochemistry | III BSc Biochem | Avery, MacLeod, McCarty Experiment | 2020-08-13 | 18 | 10 | 56 | 10 | 56 | Lecture- Discussion with board in Zoom class | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cellbiology all topics revised | 2020-08-13 | 38 | 21 | 55 | 21 | 55 | Google meet ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology all topics revised | 2020-08-13 | 28 | 8 | 22 | 8 | 22 | Google meet with ppt | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Universal gates | 2020-08-13 | 75 | 37 | 50 | 37 | 50 | Cisco WebEx | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | immunoglobulin structure | 2020-08-13 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology-The Cell Wall | 2020-08-13 | 38 | 12 | 31.8 | 12 | 31.8 | Lecturer method through Zoom meeting using PPt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology | 2020-08-13 | 28 | 15 | 53 | 15 | 53 | WhatsApp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-08-13 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-13 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Logic gates assignment | 2020-08-12 | 75 | 54 | 72 | 54 | 72 | Google classroom | Click Here |
B. Sucharitha | chemistry | M.Sc. II year | free radical reactions and mechanisms | 2020-08-12 | 13 | 5 | 40 | 5 | 40 | zoom app using board and material issued by whats app | Click Here |
Dorka | Biochemistry | III BSc Biochem | Griffith Transformation | 2020-08-12 | 18 | 13 | 72 | 13 | 72 | Lecture - Discussion with drawings | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | immunoglobulin introduction | 2020-08-12 | 18 | 14 | 78 | 14 | 78 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-08-12 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-12 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
M venkataramana | Commerce | III bcom general | Types of costing | 2020-08-12 | 50 | 18 | 36 | 18 | 36 | WebEx meeting | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | Genetic engineering and its applications | 2020-08-12 | 36 | 17 | 47.2 | 17 | 47.2 | Google meet | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Bar diagrams | 2020-08-12 | 50 | 27 | 54 | 27 | 54 | WebEx meeting | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Chandassu | 2020-08-12 | 32 | 15 | 46.8 | 13 | 40.6 | Lecture method through Zoom app using PPT | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Carnot cycle | 2020-08-12 | 77 | 30 | 38.96 | 30 | 38.96 | Webex app | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part 6 | 2020-08-12 | 13 | 5 | 40 | 7 | 40 | through zoom meeting by ppt and issued material by whatsapp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | d-block elements | 2020-08-12 | 52 | 35 | 67.3 | 35 | 67.3 | Cisco Webex and Google class room | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mitochondria | 2020-08-12 | 38 | 18 | 47 | 18 | 47 | Google meet ppt | Click Here |
B.Sucharitha | chemistry | M.Sc. II year | free radical reactions and mechanisms | 2020-08-11 | 13 | 7 | 50 | 7 | 50 | through zoom meeting by ppt and using board issued material by whatsapp | Click Here |
Dorka | Biochemistry | III BSc Biochem | Molecular Biology | 2020-08-11 | 18 | 14 | 78 | 14 | 78 | Lecture- Discussion Google meet | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-08-11 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-11 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Y.Lakshmi Prasanna | Chemistry | M.Sc. chemistry IIYear | Uv spectra part 5 | 2020-08-11 | 13 | 7 | 50 | 7 | 50 | Through Zoom meeting using ppt and material issued by whatsapp | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | Halogen compounds | 2020-08-11 | 102 | 19 | 18 | 19 | 18 | lecture | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | biotechnology introduction | 2020-08-11 | 36 | 16 | 44.44 | 14 | 38.88 | google meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Online test/quiz(bridge course test) | 2020-08-11 | 73 | 21 | 28.76 | 21 | 28.76 | Testmoz | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Logic gates | 2020-08-11 | 75 | 35 | 46 | 35 | 46 | Cisco WebEx | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | d-block elements | 2020-08-11 | 45 | 25 | 55.56 | 25 | 55.56 | Cisco webex and Google classroom | Click Here |
B.Sucharitha | chemistry | M.Sc. II year | freeradical mechanisms | 2020-08-10 | 13 | 5 | 40 | 5 | 40 | through zoom meeting by ppt and using board issued material by whatsapp | Click Here |
Dorka | Biochemistry | III BSc Biochem | Molecular Biology | 2020-08-10 | 18 | 15 | 83 | 15 | 83 | Material Sharing through Whatsapp | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | lymph node | 2020-08-10 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-08-10 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-10 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part 4 | 2020-08-10 | 13 | 7 | 50 | 7 | 50 | lecture method by zoom meeting share the material by using whats app | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Chandassu | 2020-08-10 | 32 | 10 | 31.25 | 10 | 31.25 | Lecture method through zoom app using PPT | Click Here |
M venkataramana | Commerce | III bcom general | Types of costing | 2020-08-10 | 50 | 12 | 24 | 12 | 24 | WebEx meeting and material send to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Bar diagrams | 2020-08-10 | 50 | 26 | 52 | 26 | 52 | WebEx meeting | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Nucleus | 2020-08-10 | 38 | 21 | 44 | 21 | 44 | Google meet ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Nucleus | 2020-08-10 | 30 | 13 | 43 | 13 | 43 | Google meet ppt | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | D Block Elements | 2020-08-10 | 35 | 10 | 28 | 10 | 28.5 | Lecture method using Zoom app | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | CARNOT ENGINE | 2020-08-10 | 73 | 24 | 32.8 | 24 | 32.8 | Webex app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system quiz | 2020-08-10 | 54 | 39 | 72 | 39 | 72 | Google classroom, quizizz | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-08-09 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D. Vijaya Sree | Biochemistry | III B4, B6 | organs of immune system-notes | 2020-08-09 | 16 | 16 | 100 | 100 | 100 | Click Here | |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-09 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part 4 | 2020-08-09 | 13 | 7 | 50 | 7 | 50 | lecture method through zoom meeting using ppt and material issued by whatsapp | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Oxidaton of Aldehydes,Ketones | 2020-08-09 | 13 | 6 | 46 | 5 | 39 | Zoom App meeting | Click Here |
Dr. N. Vijayalakshmi | Telugu | II B.Com (computers & Banking) | Chandassu | 2020-08-08 | 32 | 9 | 28 | 9 | 28 | Lecture method in Zoom meeting with using PPT | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | animal cell structure and function | 2020-08-08 | 34 | 17 | 50 | 14 | 41 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology, Ribosomes Golgicomplex | 2020-08-08 | 38 | 15 | 40 | 15 | 40 | Google meet ppt | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | d-block elements | 2020-08-08 | 45 | 28 | 62.2 | 28 | 62.2 | Cisco Webex meeting and Whatsapp | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part 3 | 2020-08-08 | 13 | 7 | 50 | 7 | 50 | zoom meeting sharing ppt and material issued by whatsapp | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part 3 | 2020-08-08 | 13 | 7 | 50 | 7 | 50 | zoom meeting sharing ppt and material issued by whatsapp | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology, Ribosomes Golgicomplex | 2020-08-08 | 28 | 13 | 44 | 13 | 44 | Google meet ppt | Click Here |
Dr.Ch. Bhaskara Rao | Botany | III year BZC -C1 section | Cell Biology- Cell Organells | 2020-08-08 | 38 | 20 | 52.63 | 20 | 52.63 | Lecturer method through ZOOM App | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | d-Block | 2020-08-08 | 102 | 20 | 19 | 20 | 19 | lecture | Click Here |
Kuchipudisujatha | chemistry | II Bsc C2 | d block elements | 2020-08-08 | 35 | 11 | 31.4 | 11 | 31 | by using zoom app through lecture method | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | REVERSIBLE AND IRREVERSIBLE PROCESSES | 2020-08-08 | 73 | 26 | 35.6 | 26 | 35.6 | Webex app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system | 2020-08-08 | 52 | 21 | 40 | 21 | 40 | Google classroom quizizz | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system | 2020-08-08 | 52 | 21 | 40 | 21 | 40 | Google classroom quizizz | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system | 2020-08-08 | 52 | 21 | 40 | 21 | 40 | Google classroom quizizz | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | spleen | 2020-08-07 | 18 | 10 | 56 | 10 | 56 | Cisco Webex Meetings | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | steps in photo chemical reactions | 2020-08-07 | 55 | 32 | 58.1 | 32 | 58.1 | explained content via zoom meting | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-08-07 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-07 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Endoplasmicreticulum | 2020-08-07 | 38 | 17 | 45 | 17 | 45 | Google meet | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking) | Retail Banking | 2020-08-07 | 12 | 7 | 58.33 | 7 | 58.33 | Using google meet app with video call | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | d-block elements | 2020-08-07 | 45 | 24 | 53.3 | 24 | 53.3 | Cisco webex meeting | Click Here |
M venkataramana | Commerce | III bcom general | Cost accounting | 2020-08-07 | 50 | 20 | 40 | 20 | 40 | WebEx meeting and material issued to whatsapp group | Click Here |
M venkataramana | Commerce | II bcom computer & banking | Business statistics introduction | 2020-08-07 | 50 | 27 | 54 | 27 | 54 | WebEx meeting and material issued to whatsapp group | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part 2 | 2020-08-07 | 13 | 9 | 70 | 9 | 70 | through zoom app using ppt and material is issued by whatsapp | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | Virus, viroids and mycoplasmas | 2020-08-07 | 34 | 8 | 23.52 | 8 | 23.52 | Google meet | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 rd year BSC-B1 section | Cell Biology- The cell | 2020-08-07 | 24 | 14 | 58.33 | 14 | 58.33 | Lecturer method through Zoom app | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Derivation for workdone in adiabatic process | 2020-08-07 | 73 | 26 | 35.6 | 26 | 35.6 | Webex app | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | bone marrow | 2020-08-06 | 18 | 11 | 61 | 11 | 61 | Cisco Webex Meetings | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | photo chemistry | 2020-08-06 | 32 | 55 | 58.1 | 32 | 58.1 | zoom app | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-08-06 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Restriction endonucleases | 2020-08-06 | 29 | 19 | 65.51 | 19 | 65.51 | Lecture method -screen sharing through Zoom | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-06 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-06 | 30 | 9 | 27 | 9 | 27 | WebEx meeting and material issued whatsapp group | Click Here |
M venkataramana | Commerce | III bcom general | Rural and farm credit | 2020-08-06 | 30 | 10 | 30 | 10 | 30 | WebEx meeting | Click Here |
Naga Prasanna. M | Zoology | II MZC & BiZC | Introduction to cell, History, cell theory and prokaryotic cell structure and components | 2020-08-06 | 34 | 10 | 29.4 | 10 | 29.4 | google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology, plasmamembrane | 2020-08-06 | 38 | 11 | 29 | 11 | 29 | Google meet | Click Here |
M venkataramana | Commerce | II bcom computer& banking | Business statistics introduction | 2020-08-06 | 50 | 23 | 46 | 23 | 46 | WebEx meeting | Click Here |
N.Divyasri | Commerce | III B.com | Commercial geography | 2020-08-06 | 25 | 15 | 60 | 60 | 60 | Online class through WebEx meeting app and material shared to students through WhatsApp group | Click Here |
N.Divyasri | Commerce | III B.com | Office management | 2020-08-06 | 25 | 15 | 60 | 15 | 60 | Online class through WebEx meeting app | Click Here |
N.Divyasri | Commerce | II B.com | Banking theory and practice | 2020-08-06 | 10 | 6 | 60 | 6 | 69 | Online class through WebEx meeting app and material send to students through WhatsApp group | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology, plasmamembrane | 2020-08-06 | 30 | 12 | 40 | 12 | 40 | Google meet | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Colour and catalytic properties of d-block elements | 2020-08-06 | 45 | 23 | 51.1 | 23 | 51.1 | Cisco Webex and Google classroom | Click Here |
Dr.Ch. Bhaskara Rao | Botany | 3 BZC- C1 | Cell Biology | 2020-08-06 | 35 | 20 | 57.14 | 20 | 57.14 | Lecturer method through Zoom App | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. II year | UV SPECTROSCOPY Part I | 2020-08-06 | 13 | 11 | 85 | 11 | 85 | zoom meeting through ppt and material issued by whatsapp | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Oxidation of Alcohols | 2020-08-06 | 13 | 6 | 46 | 5 | 39 | Zoom App meeting Lecture method | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | d-Block | 2020-08-06 | 102 | 15 | 14 | 15 | 14 | lec ture | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Derivation for workdone in isothermal process | 2020-08-06 | 73 | 21 | 28.7 | 21 | 28.7 | Webex app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system | 2020-08-06 | 75 | 39 | 52 | 39 | 52 | Cisco WebEx | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | thymus | 2020-08-05 | 18 | 12 | 67 | 12 | 67 | Cisco Webex Meetings | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | introduction of syllabus VI paper | 2020-08-05 | 38 | 22 | 58 | 22 | 58 | zoom meeting | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-08-05 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr.N.Ankamma | Zoology | 111 B.Sc,B.Z.C(E.M) | Introduction to Animal Biotechnology | 2020-08-05 | 29 | 19 | 65.51 | 19 | 65.51 | Lecture method-Screen sharing through Zoom | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology, Eukaryotic cell | 2020-08-05 | 38 | 12 | 36 | 12 | 36 | Google meet | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-08-05 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology, Eukaryotic cell | 2020-08-05 | 30 | 12 | 40 | 12 | 40 | Google meet | Click Here |
Y.Lakshmi Prasanna | chemistry | M.Sc. | UV SPECTROSCOPY Part I | 2020-08-05 | 13 | 10 | 77 | 10 | 77 | zoom application and materials shared by whats app | Click Here |
M venkataramana | Commerce | III bcom general | Cost sheet | 2020-08-05 | 30 | 7 | 22 | 7 | 22 | Whatsapp group video call | Click Here |
M venkataramana | Commerce | II bcom computer | Business statistics introduction | 2020-08-05 | 30 | 8 | 24 | 8 | 24 | Whatsapp group video call | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | electronic configuration and variable oxidation sates of d-block elements | 2020-08-05 | 45 | 24 | 53.3 | 24 | 53.3 | Cisco Webex meeting and Google classroom | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system | 2020-08-05 | 75 | 50 | 67 | 50 | 67 | Google classroom | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Oxidations of saturated active groups | 2020-08-05 | 13 | 7 | 54 | 5 | 39 | Zoom App meeting | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | d-Block | 2020-08-05 | 102 | 17 | 16 | 17 | 16 | Lecture | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Isothermal and adiabatic processes | 2020-08-05 | 73 | 13 | 17.8 | 13 | 17.8 | Webex app | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | Assesment | 2020-08-04 | 18 | 18 | 100 | 18 | 100 | Cisco Webex Meetings | Click Here |
Latha B | Chemistry | II BSc A1, B3, B4, B6 | Charecteristic properties of d-block elemens | 2020-08-04 | 44 | 29 | 64.4 | 29 | 64.4 | Ciusco Webex meeting and Google classroom | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Cell biology, viruses | 2020-08-04 | 38 | 9 | 25 | 9 | 25 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology, viruses | 2020-08-04 | 28 | 4 | 14 | 4 | 14 | Google meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Number system | 2020-08-04 | 75 | 44 | 58 | 44 | 58 | Cisco WebEx | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Oxidation of Aromatic rings | 2020-08-04 | 13 | 6 | 46 | 5 | 39 | Zoom app lecture method | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | d-Block | 2020-08-04 | 102 | 12 | 11 | 12 | 11 | lecture | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamics basics bridge course | 2020-08-04 | 73 | 28 | 38.3 | 28 | 38.3 | Webex app | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | organs of immune system | 2020-08-03 | 18 | 11 | 61 | 11 | 61 | Cisco Webex Meetings | Click Here |
Dr N MANJULA BHARATHI | Physics | III B.Sc.(MPCs) | Number system | 2020-08-03 | 30 | 17 | 56 | 17 | 56 | Cisco WebEx & Google classroom | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | hydro carbons&alkenesOxidations---Different oxidation process | 2020-08-03 | 13 | 4 | 31 | 4 | 31 | Zoom app meeting | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamics basics bridge course | 2020-08-03 | 73 | 25 | 34.2 | 25 | 34.2 | Webex app | Click Here |
Anusha K | Chemistry | III B.Sc. | D block | 2020-08-02 | 102 | 11 | 10 | 11 | 10 | Lecture through zoom app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | d-block elements | 2020-08-02 | 42 | 25 | 59 | 25 | 59 | Webex Meeting | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | syllabus,Oxidations introduction---Examples | 2020-08-02 | 13 | 5 | 39 | 4 | 39 | Zoom app lecture method | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamics basics bridge course | 2020-08-02 | 73 | 13 | 17.8 | 13 | 17.8 | Webex app | Click Here |
B.Vijaya Rekha | Zoology | M.Sc II year | Bioenergetics, the origins of complexity | 2020-08-01 | 25 | 9 | 36 | 9 | 36 | Google meet | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | Review of immunology | 2020-08-01 | 18 | 11 | 61 | 11 | 61 | Cisco Webex Meetings | Click Here |
Dr Latha B | Chemistry | II BSc A1, B3, B4, B6 | Introduction to syllabus and Exam Pattern | 2020-08-01 | 42 | 22 | 52.4 | 22 | 52.4 | Virtual Class through Webex | Click Here |
Dr N MANJULA BHARATHI | Physics | III B.Sc.(MPC) | Number system | 2020-08-01 | 45 | 27 | 52 | 27 | 52 | Cisco WebEx | Click Here |
y.Lakshmi Prasanna | chemistry | M.Sc. Chemistry | organic spectroscopy I | 2020-08-01 | 13 | 7 | 54 | 7 | 54 | zoom app materials shared by whats app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | )xidations | 2020-08-01 | 13 | 5 | 39 | 5 | 39 | Zoom app screen share | Click Here |
Anuaha Karumuri | chemistry | B.Sc. IIIsem | d-Block | 2020-08-01 | 102 | 10 | 9.8 | 10 | 9.8 | lecture | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamics basics bridge course | 2020-08-01 | 73 | 28 | 38.35 | 28 | 38.35 | Webex app | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | maacrophages | 2020-07-31 | 18 | 6 | 33 | 6 | 33 | Cisco Webex Meetings | Click Here |
Dr N MANJULA BHARATHI | Physics | III B. Sc(MPC) | Number system | 2020-07-31 | 45 | 26 | 52 | 26 | 52 | Cisco WebEx, Google classroom | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc(MPC&mpcs) | Thermodynamics syllabus introduction | 2020-07-30 | 73 | 23 | 31.5 | 23 | 31.5 | Webex app | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | B cells | 2020-07-29 | 18 | 7 | 40 | 7 | 40 | Cisco Webex Meetings | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | T cells | 2020-07-28 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | cells of immune system - hemotopoietic stem cells | 2020-07-25 | 18 | 7 | 39 | 7 | 39 | Cisco Webex Meetings | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | EXAM | 2020-07-24 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
P Harshitha | Statistics | I B.Sc. | Problem on regression analysis | 2020-07-24 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
P Harshitha | Statistics | I B.Sc. | Correlation vs regression | 2020-07-23 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | Adaptive Immunity | 2020-07-22 | 18 | 10 | 56 | 10 | 56 | Cisco Webex Meetings | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of regression coefficients | 2020-07-22 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | inflammation | 2020-07-21 | 18 | 10 | 56 | 10 | 56 | Cisco Webex Meetings | Click Here |
P Harshitha | Statistics | I B.Sc. | Regression coefficient | 2020-07-21 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | inflammation | 2020-07-20 | 18 | 10 | 56 | 10 | 56 | Cisco Webex Meetings | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Andhra vaangmaya Charithra - yuga vibajana | 2020-07-20 | 13 | 10 | 75 | 10 | 75 | online class through zoom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-07-19 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-19 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | vaangmyamu-saaraswathamu-saahithyam | 2020-07-18 | 13 | 10 | 75 | 10 | 75 | online class through zoom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-07-18 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-07-18 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Derivation of regression lines | 2020-07-18 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-18 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | phagocytosis | 2020-07-17 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Telugu saahitya charithra | 2020-07-17 | 13 | 10 | 75 | 10 | 75 | online class through zoom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-07-17 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-07-17 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Lines of regression | 2020-07-17 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-17 | 18 | 17 | 94 | 17 | 94 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | III BSC BIO CHEM B4,B6 | phagocytosis | 2020-07-16 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Telugu saahitya charithra | 2020-07-16 | 13 | 10 | 80 | 10 | 80 | online class through zoom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-07-16 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-16 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | chemical barriers | 2020-07-15 | 18 | 12 | 67 | 12 | 67 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-15 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Introduction to regression analysis | 2020-07-15 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-15 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | innate immunity -skin | 2020-07-14 | 18 | 10 | 56 | 10 | 56 | Cisco Webex Meetings | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on tied rank method | 2020-07-14 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | innate immunity - pH temperature | 2020-07-13 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | types of immune system introduction | 2020-07-12 | 18 | 8 | 45 | 8 | 45 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-12 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-12 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | organisation of immune system | 2020-07-11 | 18 | 7 | 40 | 7 | 40 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-11 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-11 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | introduction to immunology | 2020-07-10 | 18 | 8 | 44 | 8 | 44 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-10 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | intoduction to V sem | 2020-07-09 | 18 | 8 | 44 | 8 | 44 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-09 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-09 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on tied rank method | 2020-07-09 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
D.Vijaya Sree | Biochemistry | B4,B6 | syllabus | 2020-07-08 | 18 | 7 | 40 | 7 | 40 | Cisco Webex Meetings | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-07-08 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on spearmans rank correlation | 2020-07-08 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-08 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on spearmans correlation coefficient | 2020-07-07 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Harshitha | Statistics | I B.Sc. | Limits for spearmans correlation coefficient | 2020-07-06 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-07-05 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-05 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-07-04 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-04 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-07-03 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Derivation of spearmans correlation coefficient | 2020-07-03 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-03 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-07-02 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Rank correlation | 2020-07-02 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-02 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-07-01 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Results on correlation | 2020-07-01 | 10 | 5 | 50 | 5 | 50 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-07-01 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Results on correlation coefficient | 2020-06-30 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
P Harshitha | Statistics | I B.Sc. | Results on correlation coefficient | 2020-06-29 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
D Krishnapriya | Homescience | II B.Sc Housing and interior decoration | Importance of interior decoration | 2020-06-29 | 24 | 15 | 62.5 | 12 | 50 | Google classroom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-28 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-28 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-27 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Results on correlation coefficient | 2020-06-27 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
D krishnapriya | Homescience | II B.Sc Housing and interior decoration | Forms of fatigue | 2020-06-27 | 24 | 15 | 62.5 | 12 | 50 | Google classroom | Click Here |
D krishnapriya | Homescience | III B.sc | Resource management list out non human resources | 2020-06-27 | 20 | 10 | 50 | 10 | 50 | Google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | General psychology Ravens progressive matrices | 2020-06-27 | 20 | 10 | 50 | 10 | 50 | Googlr classroom | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-27 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-26 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Results on correlation | 2020-06-26 | 10 | 10 | 100 | 10 | 100 | Zoom application | Click Here |
D krishnapriya | Homescience | II B.Sc | Housing and interior decoration designing circulation spaces | 2020-06-26 | 24 | 15 | 62.5 | 12 | 50 | Google classroom | Click Here |
D krishnapriya | Homescience | IIIB.Sc | Resource management list out human resources | 2020-06-26 | 20 | 10 | 50 | 10 | 50 | Google class room | Click Here |
D krishnapriya | General psychology | III B.Sc | General psychology muller lyer illusion | 2020-06-26 | 20 | 10 | 50 | 10 | 50 | Google classroom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-25 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-25 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-24 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-24 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on change of origin and scale method | 2020-06-23 | 10 | 10 | 100 | 10 | 100 | Zoom application | Click Here |
D krishnapriya | Homeescience | II B.Sc | Housing and interior decoration types of furnishings | 2020-06-23 | 24 | 15 | 62.5 | 10 | 41.6 | Google classroom | Click Here |
D krishnapriya | Resource management | III B.Sc Homescience | Values goals and standards interreation between them | 2020-06-23 | 24 | 15 | 62.5 | 6 | 25 | Google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc General Psychology | Styles and types of learning | 2020-06-23 | 20 | 10 | 50 | 9 | 45 | Google class room | Click Here |
P Harshitha | Statistics | II B.Sc. | Sign test for one sample | 2020-06-22 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
D krishnapriya | Homescience | III B.Sc | General psychology Tests and types of intelligence | 2020-06-22 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc Resource management | Types of decisions and decision making process | 2020-06-22 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
D krishnapriya | Homescience | II B.Sc | Housing needs in different stages of family life cycle | 2020-06-22 | 24 | 15 | 62.5 | 10 | 41.6 | Google classroom | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on correlation coefficients | 2020-06-21 | 12 | 12 | 100 | 12 | 100 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Non parametric tests | 2020-06-21 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on time reversal tests | 2020-06-21 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-21 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-21 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-21 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Infinite Series | 2020-06-20 | 10 | 4 | 40 | 4 | 40 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of correlation coefficient | 2020-06-20 | 10 | 10 | 100 | 10 | 100 | Zoom application | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Electrical fittings and fixtures | 2020-06-20 | 24 | 15 | 62 | 10 | 41 | Google classroom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Yerrana | 2020-06-20 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D krishnapriya | Resource management | III B.Sc Homescience | Management process | 2020-06-20 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | Concept of perception and attention | 2020-06-20 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-20 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | II Bcom (Banking) | Broad Regulatory Framework And Instruments – Money Market | 2020-06-19 | 18 | 15 | 83.33 | 15 | 83.33 | Ppts sent to students through the whatsApp groups | Click Here |
M venkataramana | Commerce | II bcom general | Residential status | 2020-06-19 | 12 | 12 | 100 | 12 | 100 | Google duo app | Click Here |
M venkataramana | Commerce | II bcom | Agreement | 2020-06-19 | 30 | 20 | 66.67 | 20 | 66.67 | Whatsapp group | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Infinite Series | 2020-06-19 | 10 | 5 | 50 | 5 | 50 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of correlation coefficient | 2020-06-19 | 12 | 10 | 91 | 10 | 91 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | F test for equality of two variances | 2020-06-19 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on index numbers | 2020-06-19 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-19 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-19 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-19 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | MARKETING Product Branding and it's types | 2020-06-18 | 30 | 27 | 90 | 27 | 90 | Ppts sent to students through the whatsApp groups | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Financial services Leasing | 2020-06-18 | 25 | 20 | 80 | 20 | 80 | Ppts sent to students through the whatsapp Groups | Click Here |
M venkataramana | Commerce | II bcom general | Provident fund | 2020-06-18 | 12 | 8 | 66.67 | 8 | 66.67 | Whatsapp video call | Click Here |
M venkataramana | Commerce | II bcom | Offer | 2020-06-18 | 12 | 6 | 50 | 6 | 50 | Whatsapp video call | Click Here |
P Gousiya Khanam | Mathematics | III Semester A3 | Abstract Algebra Groups | 2020-06-18 | 30 | 18 | 60 | 18 | 60 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Measures of correlation coefficient | 2020-06-18 | 12 | 11 | 91 | 11 | 91 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Chi square test for independence of attributes | 2020-06-18 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on weighted aggregate price index | 2020-06-18 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-18 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Body mechanics principles | 2020-06-18 | 24 | 15 | 62.5 | 6 | 25 | Google classroom | Click Here |
D krishnapriya | General psychology | III B.Sc Homescience | Theories of personality | 2020-06-18 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-18 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking) | Fundamental Analysis industry life cycle | 2020-06-17 | 15 | 12 | 80 | 12 | 80 | Ppts sent to students through the whatsapp Groups | Click Here |
M venkataramana | Commerce | II bcom general | Perquisites | 2020-06-17 | 12 | 6 | 50 | 6 | 50 | Whatsapp video call | Click Here |
P Gousiya Khanam | Mathematics | III Semester A3 | Abstract Algebra Groups | 2020-06-17 | 30 | 20 | 67 | 20 | 67 | Zoom Video app | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on ratio to trend method | 2020-06-17 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Chi square test applications | 2020-06-17 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-17 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-17 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-17 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | II Bcom (Banking) | FIM impact of monetary policy | 2020-06-16 | 19 | 17 | 89.47 | 17 | 89.47 | Ppts sent to students through the whatsapp groups | Click Here |
M venkataramana | Commerce | II bcom general | Incometax | 2020-06-16 | 12 | 8 | 66.67 | 8 | 66.67 | Whatsapp video call | Click Here |
M venkataramana | Commerce | II bcom general | Business laws | 2020-06-16 | 12 | 6 | 50 | 6 | 50 | Whatsapp video call | Click Here |
P Harshitha | Statistics | I B.Sc. | Introduction to correlation | 2020-06-16 | 10 | 10 | 100 | 10 | 100 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Paired t test for difference in means and correlation coefficient | 2020-06-16 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on seasonal variations | 2020-06-16 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
N.Divyasri | Commerce | I B.com | Macro environment | 2020-06-16 | 30 | 25 | 83.33 | 25 | 83.33 | Ppt share to students through WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Financial services Commercial papers | 2020-06-15 | 28 | 26 | 92.86 | 25 | 89.29 | Ppts sent to the students through the whatsapp groups | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | Marketing product line decisions | 2020-06-15 | 39 | 35 | 89.74 | 35 | 89.74 | Ppts sent to the students through whatsapp groups | Click Here |
P Harshitha | Statistics | I B.Sc. | Theory of estimation introduction class | 2020-06-15 | 12 | 11 | 92 | 11 | 92 | Zoom application | Click Here |
M venkataramana | Incometax | II bcom general | Allowance | 2020-06-15 | 12 | 6 | 50 | 6 | 50 | Duo app | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on principal of least square method | 2020-06-15 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | T test for equality of two population means | 2020-06-15 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Gousiya Khanam | Mathematics | III Semester A3 | Abstract Algebra Groups | 2020-06-15 | 40 | 10 | 25 | 10 | 25 | Zoom Video app | Click Here |
M venkataramana | Management accounting | III bcom | Cash flow statement | 2020-06-15 | 30 | 20 | 66.67 | 20 | 66.67 | Whatsapp group | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc homescience | Define orientation aspect prospect privacy | 2020-06-15 | 24 | 13 | 54 | 9 | 37.5 | Google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Resource management consevation of resources | 2020-06-15 | 20 | 10 | 50 | 9 | 45 | google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | Observational clinical and survey methods | 2020-06-15 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
P Gousiya Khanam | Mathematics | III Semester A3 | Abstract Algebra Groups | 2020-06-14 | 40 | 38 | 95 | 38 | 95 | Zoom Video app | Click Here |
P Harshitha | Statistics | III B.Sc. | Problems on moving average method of time series | 2020-06-14 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | t test for single mean | 2020-06-14 | 10 | 5 | 50 | 5 | 50 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-14 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Arthageetham Devarakonda Balagangadhar Tilak | 2020-06-14 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | II Bcom (Banking) | Financial intermediaries and their role | 2020-06-13 | 19 | 17 | 89.47 | 16 | 84.21 | Ppts sent to the students through the whatsApp groups | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-06-13 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom general | business laws | 2020-06-13 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | Marketing product mix | 2020-06-13 | 42 | 35 | 83.33 | 33 | 78.57 | Ppts sent to students through the whatsapp Groups | Click Here |
P Gousiya Khanam | Mathematics | III Semester A3 | Abstract Algebra Groups | 2020-06-13 | 40 | 30 | 75 | 30 | 75 | Zoom Video app | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-13 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-13 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Financial services Demat account required documents | 2020-06-12 | 32 | 28 | 87.5 | 28 | 87.5 | Ppts sent to the students through the whatsapp Groups | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-06-12 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom general | income tax | 2020-06-12 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking) | Fundamental Analysis Industry Analysis | 2020-06-12 | 17 | 16 | 94.12 | 15 | 88.24 | Ppts sent to the students through the whatsapp groups | Click Here |
K.Venugopalarao | Commerce | III B.com | Ratio analysis | 2020-06-12 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
K.Venugopalarao | Commerce | I B.com | Business economics | 2020-06-12 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
P Harshitha | Statistics | III B.Sc. | Abridge life table | 2020-06-12 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-12 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-12 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on normal distribution | 2020-06-12 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | Product life cycle | 2020-06-11 | 40 | 30 | 75 | 30 | 75 | Ppts sent to the students thorough the whatsapp groups | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Financial services Demat services | 2020-06-11 | 30 | 25 | 83.33 | 25 | 83.33 | Material sent to the students through the whatsapp Groups | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-06-11 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom general | income tax | 2020-06-11 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
P Harshitha | Statistics | II B.Sc. | Test for two correlation coefficients | 2020-06-11 | 10 | 5 | 50 | 5 | 50 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Construction of life tables | 2020-06-11 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
G V Bhaskar | Mathematics | III Semester | Abstract Algebra Groups | 2020-06-11 | 50 | 45 | 90 | 45 | 90 | Zoom Video app | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Tikkana | 2020-06-11 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-11 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Problems on normal distribution | 2020-06-11 | 10 | 4 | 40 | 4 | 40 | Zoom application | Click Here |
N. BHAGYA RAJU | Commerce | II Bcom (Banking) | Money Market Instruments | 2020-06-10 | 15 | 13 | 86.67 | 13 | 86.67 | Ppts sent to the students through the whatsapp groups | Click Here |
M venkataramana | commerce | III bcom | cash flow statement | 2020-06-10 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | III bcom | ExIM bank | 2020-06-10 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
P Harshitha | Statistics | III B.Sc. | Concept of life tables | 2020-06-10 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Test for single correlation coefficients | 2020-06-10 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Gousiya Khanam | Mathematics | III Semester | Abstract Algebra Groups | 2020-06-10 | 40 | 28 | 70 | 28 | 70 | Zoom Video app | Click Here |
N.Divyasri | Commerce | I B.com computers | Top ERP vendors | 2020-06-10 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-06-10 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-10 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of Cauchy distribution | 2020-06-10 | 10 | 5 | 50 | 5 | 50 | Zoom application | Click Here |
P Harshitha | Statistics | I B.Sc. | Cauchy distribution | 2020-06-09 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
M venkataramana | commerce | III bcom | funds flow statement | 2020-06-09 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom computer | commercial bank | 2020-06-09 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
P Harshitha | Statistics | II B.Sc. | Test for two proportions | 2020-06-09 | 10 | 5 | 50 | 5 | 50 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Measures of population growth | 2020-06-09 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
G V Bhaskar | Mathematics | III Semester | Abstract Algebra Groups | 2020-06-09 | 50 | 42 | 84 | 42 | 84 | Zoom Video app | Click Here |
K.Venugopalarao | Commerce | I B.com | Share capital short answer questions | 2020-06-09 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking) | Types of economic indicators | 2020-06-09 | 17 | 15 | 88.24 | 15 | 88.24 | Ppts sent to the students through whatsapp groups | Click Here |
P Harshitha | Statistics | II B.Sc. | Test for single proportion | 2020-06-08 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Securitization | 2020-06-08 | 32 | 28 | 87.5 | 28 | 87.5 | Ppts sent to the students through the whatsApp groups | Click Here |
M venkataramana | commerce | III bcom | management accounting | 2020-06-08 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
G v Bhaskar | Mathematics | III Semester | Groups | 2020-06-08 | 50 | 43 | 86 | 43 | 86 | Zoom Video app | Click Here |
N.Divyasri | Commerce | III B.com | Differences between products and services marketing | 2020-06-08 | 30 | 25 | 83.33 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
P Harshitha | Statistics | III B.Sc. | Measures of fertility | 2020-06-08 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-06-07 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-07 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
G V Bhaskar | Mathematics | III Semester | Abstract Algebra Groups | 2020-06-07 | 50 | 35 | 70 | 35 | 70 | Zoom Video app | Click Here |
P Harshitha | Statistics | III B.Sc. | Measures of mortality | 2020-06-07 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Test for two standard deviations | 2020-06-07 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-06-06 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom general | income tax | 2020-06-06 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-06-06 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Art elements and art principles | 2020-06-06 | 24 | 10 | 41.6 | 3 | 12.5 | Assignment-google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | Housing and interior decoration quiz | 2020-06-06 | 20 | 10 | 50 | 9 | 45 | Google form google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | Nutrition | 2020-06-06 | 20 | 10 | 50 | 9 | 45 | Google form google classroom | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-06 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | II Bcom (Banking) | Finanancial instrumens and markets | 2020-06-06 | 18 | 15 | 83.33 | 15 | 83.33 | Ppts sent to the students through whats app groups | Click Here |
P Harshitha | Statistics | I B.Sc. | Gamma distribution | 2020-06-06 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Gousiya Khanam | Mathematics | 1 year A 3 | The Plane | 2020-06-06 | 20 | 19 | 95 | 19 | 95 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Abstract Algebra Groups | 2020-06-06 | 50 | 40 | 80 | 40 | 80 | Zoom Video app | Click Here |
P Harshitha | Statistics | III B.Sc. | Vital statistics | 2020-06-06 | 10 | 5 | 50 | 5 | 50 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Test for two means | 2020-06-06 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-06-05 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Art elements and principles | 2020-06-05 | 24 | 10 | 41.6 | 4 | 16.6 | Assignment -google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Housing and interior decoratinn quiz | 2020-06-05 | 20 | 10 | 50 | 9 | 45 | Google form google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Nutrition quiz | 2020-06-05 | 20 | 10 | 50 | 10 | 50 | Google form google classroom | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Pothana | 2020-06-05 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of exponential distribution | 2020-06-05 | 10 | 4 | 40 | 4 | 40 | Zoom application | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | Advantages of market segmentation | 2020-06-05 | 32 | 28 | 87.5 | 28 | 87.5 | Ppts sent to the students through the whatsapp groups | Click Here |
Shaik Jubeda | Physics | II BSc(MPC&mpcs) | Optics wedge shaped air film | 2020-06-05 | 79 | 12 | 15.19 | 12 | 15.19 | Webex meet app | Click Here |
M venkataramana | commerce | III bcom | management accounting | 2020-06-05 | 30 | 20 | 66.67 | 20 | 66.67 | ppt in WhatsApp group | Click Here |
P Gousiya Khanam | Mathematics | 1 year A 3 | The Plane | 2020-06-05 | 20 | 13 | 65 | 13 | 65 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-06-05 | 15 | 3 | 20 | 3 | 20 | Zoom Video app | Click Here |
K.Venugopalarao | Commerce | II B.com | Fundsflow | 2020-06-05 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
N.Divyasri | Commerce | I B.com computers | Fundamental technology | 2020-06-05 | 30 | 25 | 83.33 | 25 | 66.67 | Material send to students through WhatsApp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-06-04 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Art elements and art principles | 2020-06-04 | 24 | 18 | 75 | 6 | 25 | Google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Housing and interior decoration quiz | 2020-06-04 | 20 | 10 | 50 | 9 | 45 | Google form google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Nutrition quiz | 2020-06-04 | 20 | 10 | 50 | 9 | 45 | Google form google classroom | Click Here |
P Gousiya Khanam | Mathematics | 1 year A 3 | The Plane | 2020-06-04 | 20 | 9 | 45 | 9 | 45 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-06-04 | 10 | 4 | 40 | 4 | 40 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Uniform distribution with its properties | 2020-06-04 | 8 | 2 | 25 | 2 | 25 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | C.S.O and N.S.S.O | 2020-06-04 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Large sample test single mean | 2020-06-04 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Discus the general awareness on fisheries science quiz | 2020-06-04 | 29 | 9 | 30 | 9 | 30 | Videocal by Google duo app | Click Here |
K.Venugopalarao | Commerce | II B.com | Funds flow | 2020-06-04 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
M venkataramana | commerce | III bcom | cost accounting | 2020-06-04 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Nannaya | 2020-06-03 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Art principles | 2020-06-03 | 24 | 18 | 75 | 11 | 45 | Assignment-google class room | Click Here |
D krishnapriya | Homescience | III B.sc | Housing and interior decoration quiz | 2020-06-03 | 20 | 10 | 50 | 9 | 45 | Google form google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | Nutrition quiz | 2020-06-03 | 20 | 10 | 50 | 10 | 50 | Google form googe quiz | Click Here |
Dr. Guntupalli Gowri | Special Telugu | II BA (S.H.T) IVth Sem | Vamanavatharam | 2020-06-03 | 18 | 17 | 94 | 17 | 17 | Online course, material circulated over WhatsApp https://drive.google.com/file/d/10U7cAUYpUvZr_qVgaK_yy5ziA7H_sifr/view?usp=sha | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (G) | Venture capital | 2020-06-03 | 30 | 25 | 83.33 | 25 | 83.33 | Ppts sent to the students through the whatsApp Groups | Click Here |
M venkataramana | commerce | III bcom | management accounting | 2020-06-03 | 30 | 20 | 66.67 | 20 | 66.67 | ppt sent to WhatsApp group | Click Here |
K.Venugopalarao | Commerce | II B.com | Problem on ratios | 2020-06-03 | 30 | 20 | 66.67 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Menu plans calculation to different age groups | 2020-06-03 | 23 | 15 | 70 | 15 | 70 | Watsapp group | Click Here |
P Gousiya Khanam | Mathematics | 1 year A 3 | The Plane | 2020-06-03 | 20 | 11 | 55 | 11 | 55 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-06-03 | 10 | 5 | 50 | 5 | 50 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Limiting case of binomial and poisson to normal distribution | 2020-06-03 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Official statistics | 2020-06-03 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Poisson and normal distribution (np lemma) | 2020-06-03 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
D krishna priya | Housing and interior decoration | II B.Sc Homescience | Art elements | 2020-06-02 | 24 | 18 | 75 | 10 | 41.6 | Assignment -google class room | Click Here |
D krishnapriya | Homescience | III B.sc | Housing and interior decoration | 2020-06-02 | 20 | 10 | 50 | 9 | 45 | Google form google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Nutrition quiz | 2020-06-02 | 20 | 10 | 50 | 10 | 50 | Google form google classroom | Click Here |
K.Venugopalarao | Commerce | II B.com | Financial ratios | 2020-06-02 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
N.Divyasri | Commerce | I B.com computers | Enterprise resource planning risks and benefits | 2020-06-02 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking) | Economic indicators | 2020-06-02 | 17 | 15 | 88.23 | 15 | 88.23 | Ppts sent to the students through the whatsApp groups | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Sangraha vyaakyalu | 2020-06-02 | 18 | 17 | 94 | 18 | 94 | shared material through whatsapp | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Gosangi | 2020-06-02 | 17 | 17 | 100 | 17 | 100 | Class through zoom app and shared study material through WhatsApp group | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-06-02 | 15 | 6 | 40 | 6 | 40 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Areas property of normal distribution | 2020-06-02 | 10 | 6 | 60 | 6 | 60 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Splicing,deflation of index numbers | 2020-06-02 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Binomial distribution (np lemma) | 2020-06-02 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
D krishna priya | Housing and interior decoration | II B.Sc Homescience | Art elements | 2020-06-01 | 24 | 18 | 75 | 12 | 50 | Google class room | Click Here |
D krishnapriya | Homescience | III B.Sc | Housing and interior decoration | 2020-06-01 | 20 | 10 | 50 | 9 | 45 | Google form google classroom | Click Here |
D krishnapriya | Homescience | III B.Sc | Nutrition quiz | 2020-06-01 | 20 | 10 | 50 | 10 | 50 | Google form google classroom | Click Here |
K.Venugopalarao | Commerce | III B.com | Ratio analysis | 2020-06-01 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
Shaik Jubeda | Physics | II BSc(MPC&mpcs) | Optics Resolving power of grating | 2020-06-01 | 79 | 13 | 16.45 | 13 | 16.45 | Webex meet app | Click Here |
M venkataramana | commerce | III bcom | funds flow statement | 2020-06-01 | 30 | 20 | 66.67 | 20 | 66.67 | ppt in WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &General) | Market segmentation | 2020-06-01 | 40 | 30 | 75 | 30 | 30 | Ppts sent to the students through whatsApp groups | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Doubts clarification | 2020-06-01 | 22 | 9 | 25.12 | 9 | 25.12 | Doubts clarification through WhatsApp conference call | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Sangraha vyaakyalu | 2020-06-01 | 18 | 17 | 94 | 18 | 94 | Shared material through whatsapp | Click Here |
P Harshitha | Statistics | I B.Sc. | Q.D:M.D:S.D in normal distribution | 2020-06-01 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Chain and fixed based index numbers | 2020-06-01 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Neymann pearsons lemma theorem | 2020-06-01 | 10 | 9 | 90 | 9 | 90 | Zoom application | Click Here |
N.Divyasri | Commerce | I B.com computers | Evaluation of ERP | 2020-05-31 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (G) | Merchant Banking System | 2020-05-31 | 28 | 24 | 87.71 | 24 | 87.71 | PPTs sent to the students through whatsApp groups | Click Here |
G V Bhaskar | Mathematics | 1 year A 3 | Right Line | 2020-05-31 | 20 | 4 | 20 | 4 | 20 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-05-31 | 15 | 4 | 27 | 4 | 27 | Zoom Video app | Click Here |
P Harshitha | Statistics | III B.Sc. | Wholesale price index numbers | 2020-05-31 | 10 | 8 | 80 | 10 | 80 | Zoom application | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Chaamakoru Venkata kavi chematkaara kavitha viseshaalu | 2020-05-31 | 18 | 17 | 94 | 18 | 94 | shared material through whatsapp | Click Here |
P Harshitha | Statistics | I B.Sc. | Mean=median=mode | 2020-05-31 | 20 | 14 | 70 | 14 | 70 | Zoom application | Click Here |
P Harshitha | Statistics | II B.Sc. | Concepts of Hypothesis | 2020-05-31 | 10 | 10 | 100 | 10 | 100 | Zoom application | Click Here |
M venkataramana | commerce | III bcom | cash flow statement | 2020-05-30 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Endocrine system | 2020-05-30 | 22 | 18 | 81.56 | 18 | 81.56 | Video lesson shared | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | Marketing buying decision process | 2020-05-30 | 40 | 30 | 75 | 30 | 75 | Ppts sent to the students through the whatsapp | Click Here |
Shaik Jubeda | Physics | II BSc(MPC&mpcs) | Optics types of optical fibre s | 2020-05-30 | 79 | 12 | 15.19 | 12 | 15.19 | Webex meet app | Click Here |
M venkataramana | commerce | IIBcom | Banking | 2020-05-30 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | All topics | 2020-05-30 | 17 | 14 | 82.35 | 14 | 82.35 | Clarified doubts through zoom app and shared study material through WhatsApp group | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | NMR spectroscopy: Equivalent and Non-equivalent protons, Chemical shift | 2020-05-30 | 49 | 10 | 20.4 | 10 | 20.4 | Cisco Webex meeting | Click Here |
G V Bhaskar | Mathematics | 1 year A 3 | Right Line | 2020-05-30 | 20 | 11 | 55 | 11 | 55 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Sequences | 2020-05-30 | 15 | 3 | 20 | 3 | 20 | Zoom Video app | Click Here |
P Harshitha | Statistics | III B.Sc. | Cost of living index numbers | 2020-05-30 | 31 | 8 | 26 | 8 | 26 | Zoom application | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance -scientific and common names | 2020-05-30 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson sharing and discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance-scientific names &common names | 2020-05-30 | 13 | 11 | 84.6 | 11 | 84.6 | video lesson sharing through whatsapp &discussion | Click Here |
P Harshitha | Statistics | II B.Sc. | Testing of hypothesis | 2020-05-30 | 10 | 8 | 80 | 8 | 80 | Zoom application | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | bits | 2020-05-30 | 24 | 24 | 100 | 18 | 75 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D Krishna Priya | General psychology | III B.Sc Homescience | Bits | 2020-05-30 | 20 | 16 | 80 | 6 | 30 | Quiz framed by google form and assigned in google classroom | Click Here |
D Krishna Priya | Resource management | III B.Sc Homescience | Pg entrance practice bits | 2020-05-30 | 20 | 16 | 80 | 6 | 30 | Quiz framed by using google forms and assigned in google classroom | Click Here |
P Harshitha | Statistics | I B.Sc. | M.g.f of normal distribution | 2020-05-30 | 10 | 7 | 70 | 7 | 70 | Zoom application | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (G) | Fund based and fee based Activities of Financial services | 2020-05-29 | 28 | 25 | 89.29 | 25 | 89.29 | Ppts sent to students through the whatsApp groups | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of normal distribution | 2020-05-29 | 31 | 7 | 18 | 7 | 18 | Zoom application | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A (S.H.T) | Vemana sathakam | 2020-05-29 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-05-29 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
P Harshitha | Statistics | III B.Sc. | Criteria of good index numbers | 2020-05-29 | 31 | 10 | 32 | 10 | 32 | Zoom application | Click Here |
G V Bhaskar | Mathematics | 1 year A 3 | Right Line | 2020-05-29 | 20 | 12 | 60 | 12 | 60 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-05-29 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
K.Venugopalarao | Commerce | II B.com | Valuation of shares problem | 2020-05-29 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance practice paper-general zoology | 2020-05-29 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing of video lessonand discussion | Click Here |
M venkataramana | commerce | IIBcom general | income tax | 2020-05-29 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
D krishnapriya | Housing and Interior decoration | II B.Sc Homescience | Bits | 2020-05-29 | 24 | 24 | 100 | 19 | 79 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D krishna priya | General psychology | III B.Sc Homescience | Bits | 2020-05-29 | 20 | 16 | 80 | 5 | 25 | Quiz framed by Google form and assigned in google classroom | Click Here |
D Krishna priya | Resource management | III B.Sc Homescience | Pg entrance practice bits | 2020-05-29 | 20 | 3 | 15 | 3 | 100 | Quiz framed by google forms and assigned in google classroom | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | Marketing Environment | 2020-05-28 | 40 | 28 | 70 | 28 | 70 | Using ppts and sent to the students through the whatsapp | Click Here |
M venkataramana | commerce | III bcom | cash flow statement | 2020-05-28 | 30 | 20 | 66.67 | 20 | 66.67 | what's app group | Click Here |
M venkataramana | commerce | IIBcom general | income tax | 2020-05-28 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
K.Venugopalarao | Commerce | II B.com | Valuation of shares problem | 2020-05-28 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
P Harshitha | Statistics | I B.Sc. | Normal distribution | 2020-05-28 | 39 | 7 | 18 | 7 | 18 | Zoom application | Click Here |
P Harshitha | Statistics | III B.Sc. | Clarification of the index numbers | 2020-05-28 | 31 | 11 | 35 | 11 | 35 | Zoom application | Click Here |
G V Bhaskar | Mathematics | 1 year A 3 | Right Line | 2020-05-28 | 20 | 11 | 55 | 11 | 55 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-05-28 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Sumathi sathakam Badhena | 2020-05-28 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance practice bits-general zoology | 2020-05-28 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing and discussion | Click Here |
D Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Bits | 2020-05-28 | 24 | 24 | 100 | 19 | 79 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D Krishna Priya | General psychology | III B.Sc Homescience | Bits | 2020-05-28 | 20 | 16 | 80 | 7 | 35 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D Krishna Priya | Resource management | III B.Sc Homescience | Pg entrance practice bits | 2020-05-28 | 20 | 9 | 45 | 9 | 100 | Quiz framed by using google forms and assigned in google classroom | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (G) | Non Banking Financial companies | 2020-05-27 | 32 | 25 | 78.12 | 25 | 78.12 | Ppts sent to students through wahtsapp groups | Click Here |
Shaik Jubeda | Physics | II BSc(MPC&mpcs) | Optics fibre optics | 2020-05-27 | 79 | 16 | 20.25 | 16 | 20.25 | Webex meet app | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-05-27 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom general | income tax | 2020-05-27 | 30 | 15 | 50 | 15 | 50 | whatsapp group | Click Here |
P Harshitha | Statistics | III B.Sc. | Construction of index numbers | 2020-05-27 | 31 | 8 | 28 | 8 | 28 | Zoom application | Click Here |
K.Venugopalarao | Commerce | II B.com | Valuation of shares | 2020-05-27 | 30 | 25 | 83.33 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Sathakasaahithyam visistatha Lakshanaaalu | 2020-05-27 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance practice paper-general zoology | 2020-05-27 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing and discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance practice paper-general zoology | 2020-05-27 | 13 | 11 | 84.6 | 11 | 84.6 | whatsapp sharing and discussion | Click Here |
N.Divyasri | Commerce | I B.com | Enterprise resource planning | 2020-05-27 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Bits | 2020-05-27 | 24 | 24 | 100 | 22 | 91 | Quiz is framed by using google form and assigned in google class room | Click Here |
D Krishna Priya | General psychology | III B.Sc Homescience | Bits | 2020-05-27 | 20 | 16 | 80 | 11 | 55 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D Krishna Priya | Resource management | III B.Sc Homescience | Pg entrance practice bits | 2020-05-27 | 20 | 16 | 80 | 3 | 15 | Quiz framed by using google form and assigned in google class room | Click Here |
M Padmaja | Political Science | I BA | Presidential Government features and merits and demerits | 2020-05-26 | 40 | 35 | 87.5 | 35 | 87.5 | Click Here | |
P Harshitha | Statistics | I B.Sc. | Negative binomial distribution Limiting case to PD | 2020-05-26 | 39 | 10 | 26 | 10 | 26 | Zoom application | Click Here |
K.Venugopalarao | Commerce | B.com | Share capital | 2020-05-26 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-05-26 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
M venkataramana | commerce | IIBcom general | Exempted income | 2020-05-26 | 30 | 20 | 66.67 | 20 | 66.67 | pdf in WhatsApp group | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Koyila | 2020-05-26 | 17 | 17 | 100 | 17 | 100 | Class through zoom app and shared study material through WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &General) | 4ps of marketing | 2020-05-26 | 30 | 22 | 73 | 22 | 73 | Materials send through the whatsApp group's with ppts | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Raghunaada Bhupaluni Prasasthi | 2020-05-26 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-cells of immune system revision | 2020-05-26 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing and discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Cells of immune system Revision | 2020-05-26 | 13 | 11 | 84.6 | 11 | 84.6 | video lesson and questionare shared through whatsapp and discussion | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Jar and circular hatcheries diagrams | 2020-05-26 | 29 | 16 | 55.17 | 16 | 55.17 | Click Here | |
G V Bhaskar | Mathematics | 1 year Section - A3 | Right Line | 2020-05-26 | 20 | 15 | 75 | 15 | 75 | Zoom Video app | Click Here |
P Gousiya Khanam | Mathematics | 2 year | Sequences | 2020-05-26 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
D krishnapriya | Housing and interior decoration | II B.Sc Homescience | Bits | 2020-05-26 | 24 | 24 | 100 | 24 | 100 | Quiz is framed by using google form and assigned in google class room | Click Here |
D krishnapriya | General Psychology | III B.Sc Homescience | Bits | 2020-05-26 | 20 | 16 | 80 | 15 | 75 | Quiz is framed by ising google form and assigned in google classroom | Click Here |
D krishnapriya | Resource management | III B.Sc Homescience | Pg entrance Practice bits | 2020-05-26 | 20 | 16 | 80 | 9 | 45 | Quiz framed by using google form and assigned in google classroom | Click Here |
M venkataramana | commerce | IIBcom | commercial bank | 2020-05-25 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking) | Fundamental Analysis | 2020-05-25 | 18 | 15 | 83.33 | 15 | 83.33 | Providing material through the whatsapp groups with ppts | Click Here |
G.sita | Electronics | 3 BSC MECS (CIUSTER) | Getting embedded system into target system | 2020-05-25 | 11 | 11 | 100 | 11 | 100 | YouTube link shared through WhatsApp group | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Brackish water fishes | 2020-05-25 | 29 | 10 | 34.48 | 10 | 34.48 | Google duo app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | vachana kavya rachana parinaamam | 2020-05-25 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
M venkataramana | commerce | III bcom | Break even chart | 2020-05-25 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group pdf | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Koyila | 2020-05-25 | 17 | 17 | 100 | 17 | 100 | Shared study material through WhatsApp group | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Namnikaranam | 2020-05-25 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
P Harshitha | Statistics | III B.Sc. | Index numbers | 2020-05-25 | 31 | 9 | 30 | 9 | 30 | Zoom application | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Types of immunity | 2020-05-25 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson aand assignment shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Immunology-Types of immunity | 2020-05-25 | 13 | 11 | 84.6 | 11 | 84.6 | whatsapp sharing and discussion | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Circulation | 2020-05-25 | 22 | 18 | 81.56 | 18 | 81.56 | WhatsApp group YouTube links shared | Click Here |
G V Bhaskar | Mathematics | 2 year | Sequences | 2020-05-25 | 15 | 4 | 26 | 4 | 26 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | M.c.c.q. on unit I and unit II | 2020-05-25 | 39 | 14 | 36 | 14 | 36 | Zoom application | Click Here |
D Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Bits | 2020-05-25 | 24 | 24 | 100 | 22 | 91.6 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D Krishna priya | General Psychology | III B.Sc Homescience | Bits | 2020-05-25 | 20 | 16 | 80 | 16 | 100 | Quiz is framed by using google form and assigned in google classroom | Click Here |
D Krishnaproya | Resource management | III B.Sc Homescience | Bits | 2020-05-25 | 20 | 16 | 80 | 4 | 20 | Quiz framed by using google form and assigned in google classroom | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara Saasthram - Bharatheeya alankaarikulu | 2020-05-24 | 14 | 12 | 85.71 | 12 | 85.71 | Whats app group | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | yakshagaanaalu | 2020-05-24 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
P Harshitha | Statistics | I B.Sc. | Mcqs given on expectations and discrete distributions | 2020-05-24 | 39 | 7 | 18 | 7 | 18 | Zoom application | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Koyila(adhunika padhyabagham) | 2020-05-24 | 17 | 17 | 100 | 17 | 100 | Class through zoom app and shared study material through WhatsApp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | Right Line | 2020-05-24 | 20 | 16 | 80 | 16 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Sequences | 2020-05-24 | 15 | 4 | 27 | 4 | 27 | Zoom Video app | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (G) | Importance of Financial Sevices | 2020-05-24 | 25 | 20 | 80 | 20 | 80 | Material send to students through the whatsapp group with ppt | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara Saasthram - Drusya Kaavyaalu | 2020-05-23 | 14 | 12 | 85.71 | 12 | 85.71 | What's app group | Click Here |
P Harshitha | Statistics | I B.Sc. | Negative binomial distribution | 2020-05-23 | 39 | 13 | 33 | 13 | 33 | Zoom application Notes explanation | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Naayaka Rajula Paalana lo Sahithyam | 2020-05-23 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
M venkataramana | commerce | III bcom | ratio analysis | 2020-05-23 | 40 | 30 | 75 | 25 | 62.5 | material issued whats up group | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Koyila | 2020-05-23 | 17 | 17 | 100 | 17 | 100 | Class through zoom app and shared study material through WhatsApp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Explanation of Salt water phase diagram | 2020-05-23 | 49 | 10 | 20.4 | 10 | 20.4 | Revision by lecture method through Cisco Webex meeting | Click Here |
M venkataramana | commerce | IIBcom general | total income | 2020-05-23 | 30 | 20 | 66.67 | 20 | 66.67 | whats up group | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Namnikaranam | 2020-05-23 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
N.Bhagyaraju | Commerce | III B.com | Marketing mix | 2020-05-23 | 30 | 25 | 83.33 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
N.Divyasri | Commerce | III B.com | Vouching | 2020-05-23 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Embryology | 2020-05-23 | 22 | 18 | 81.56 | 18 | 81.56 | WhatsApp group YouTube links shared | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance General zoology | 2020-05-23 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing and discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance General zoology | 2020-05-23 | 13 | 11 | 84.6 | 11 | 84.6 | whatsapp sharing of vlesson and discussion | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | Right Line | 2020-05-23 | 40 | 18 | 45 | 18 | 45 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-23 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
M venkataramana | commerce | IIBcom computer | ExIM bank | 2020-05-22 | 30 | 15 | 50 | 15 | 50 | WhatsApp group | Click Here |
M venkataramana | commerce | III bcom | cash flow statement | 2020-05-22 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram -Drusya Kaavyaalu | 2020-05-22 | 14 | 14 | 100 | 14 | 100 | What's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Given assignment on mosfet | 2020-05-22 | 30 | 25 | 83.33 | 25 | 83.33 | Assignment given through WhatsApp group | Click Here |
M PADMAJA | Political Science | I BA | Parliamentary Government features in India | 2020-05-22 | 60 | 40 | 66.67 | 40 | 66.67 | Lecture method through whatsapp | Click Here |
M PADMAJA | Political Science | III BA | Quiz to III BA students | 2020-05-22 | 16 | 14 | 87.5 | 14 | 87.5 | Click Here | |
Shaik jubeda | Physics | II BSc(MPC&mpcs) | Thermister | 2020-05-22 | 79 | 17 | 21.52 | 17 | 21.52 | Webex meet app | Click Here |
K.Venugopalarao | Commerce | I B.com | Partnership accounts | 2020-05-22 | 30 | 30 | 100 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Pb Ag system and discussion on IR spectroscopy with MCQs | 2020-05-22 | 49 | 12 | 24.5 | 12 | 24.5 | Cisco webex meeting | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | UV spectroscopy for entrance | 2020-05-22 | 11 | 3 | 27.3 | 3 | 27.3 | Cisco webex meeting | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance Respiratory system | 2020-05-22 | 26 | 22 | 84.6 | 20 | 76.92 | Content and question paper shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance Respiratory system | 2020-05-22 | 13 | 11 | 84.6 | 11 | 84.6 | Google duo discussion | Click Here |
N.Divyasri | Commerce | III B.com | Auditing | 2020-05-22 | 30 | 20 | 66.67 | 20 | 66.67 | Material send to students through WhatsApp group with ppt | Click Here |
N.Bhagyaraju | Commerce | III B.com | Marketing | 2020-05-22 | 30 | 20 | 66.67 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Chinese carps | 2020-05-22 | 29 | 5 | 17.24 | 5 | 17.24 | Online video class by Google duo app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Madhuraanthakam Raja ram | 2020-05-22 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Problems in fundamental of vibrations | 2020-05-22 | 70 | 11 | 15.7 | 11 | 15.7 | Webex meet | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-22 | 15 | 4 | 27 | 4 | 27 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Hyper Geometric Distribution | 2020-05-22 | 39 | 12 | 31 | 12 | 31 | Zoom application | Click Here |
M venkataramana | commerce | III bcom | cash flow statement | 2020-05-21 | 30 | 20 | 66.67 | 20 | 66.67 | WhatsApp group | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Sravya Kaavyaalu | 2020-05-21 | 14 | 12 | 85.71 | 12 | 85.71 | What's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Doubts clarification of fet | 2020-05-21 | 30 | 3 | 10 | 3 | 10 | Webex meet | Click Here |
P Harshitha | Statistics | I B.Sc. | Hypergeometric distribution | 2020-05-21 | 39 | 12 | 31 | 12 | 31 | Zoom application | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Sivaraju pattabishekam | 2020-05-21 | 17 | 17 | 100 | 17 | 100 | Class through zoom app and shared study material through WhatsApp | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Fourier theorem-- evaluation of Fourier coefficients | 2020-05-21 | 70 | 14 | 20 | 14 | 20 | Webex meet | Click Here |
K.Venugopalarao | Commerce | B.com | Planning in India | 2020-05-21 | 30 | 25 | 83.33 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
Dorka | Biochemistry | I BSc Biochem | GOOGLE CLASSROOM | 2020-05-21 | 22 | 15 | 100 | 63 | 45 | Material through Google Classroom | Click Here |
Dorka | Biochemistry | III BSc Biochem | Google Classroom | 2020-05-21 | 14 | 9 | 64 | 7 | 50 | Material / Video through Google classroom | Click Here |
MADASU LAKSHMI HIMA BINDHU | Microbiology | III MBC&MZC | Virology | 2020-05-21 | 24 | 15 | 62.5 | 15 | 62.5 | Quiz for pg entrance coaching | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Cultivable barakish water fishes assignment | 2020-05-21 | 29 | 11 | 37.93 | 11 | 37.93 | Whatsap assignment | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Samyukta Vaakyam | 2020-05-21 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Frog development | 2020-05-21 | 22 | 18 | 81.56 | 18 | 81.56 | WhatsApp group YouTube links shared | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance practice paper-Human heart | 2020-05-21 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson aned question paper shared through whatsapp and discussed | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance practice paper-Human heart | 2020-05-21 | 13 | 11 | 84.6 | 11 | 84.6 | question paper shared through whatsapp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Phase rule and Water phase system | 2020-05-21 | 49 | 10 | 20.4 | 10 | 20.4 | Webex meeting | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Rachayathri Kanaparthi Varalakshmamma | 2020-05-21 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | Right Line | 2020-05-21 | 40 | 15 | 71 | 15 | 71 | Zoom Video app | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Sivaraju pattabishekam | 2020-05-20 | 17 | 17 | 100 | 17 | 100 | Shared study material through WhatsApp group | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | kavi Potlapalli Ramarao | 2020-05-20 | 18 | 17 | 94 | 18 | 94 | shared material through whatsapp | Click Here |
K.Venugopalarao | Commerce | B.com | Planning in India | 2020-05-20 | 30 | 25 | 83.33 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Detection methods,Sears method,applications of Ultrasonics | 2020-05-20 | 70 | 17 | 24.2 | 17 | 24.2 | Webex meet | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | IMC | 2020-05-20 | 29 | 3 | 10.13 | 3 | 10.13 | Online video class by Google duo app | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Samslista Vaakyam | 2020-05-20 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-05-20 | 39 | 13 | 34 | 13 | 34 | Zoom application | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Hypersensitivity 2 marks questions exam | 2020-05-20 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson and question paper shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Hypersensitivity 2 marks questions exam | 2020-05-20 | 13 | 11 | 84.6 | 11 | 84.6 | Click Here | |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Embryology | 2020-05-20 | 22 | 18 | 81.56 | 18 | 81.56 | WhatsApp group YouTube links shared | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Vanthoffs theory and significance of vanthoffs factor | 2020-05-20 | 49 | 12 | 24.5 | 12 | 24.5 | Cisco webex meeting for virtual class | Click Here |
Dr Latha B | Chemistry | III BSc Cluster | followup and updates about PG entrance preparation | 2020-05-20 | 11 | 5 | 45.45 | 5 | 45.45 | Virtual discussion through Cisco Webex meeting | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-20 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Gadya Kaavyaalu | 2020-05-20 | 14 | 12 | 85.71 | 12 | 85.71 | What's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Enhancement mosfet | 2020-05-20 | 30 | 25 | 83.33 | 25 | 83.33 | Lesson material shared through WhatsApp group | Click Here |
Shaik jubeda | Physics | II BSc(MPC&mpcs) | Optics Applications of lasers | 2020-05-20 | 79 | 14 | 17.72 | 14 | 17.72 | Webex meet app | Click Here |
M.Indiramma | English | I.BSc | Correction of sentence | 2020-05-20 | 25 | 8 | 32 | 8 | 32 | Zoom app | Click Here |
M.Indiramma | English | II BA | Note making | 2020-05-20 | 28 | 8 | 28.57 | 8 | 28.57 | WebEx meet | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Induced breeding | 2020-05-19 | 29 | 16 | 55.17 | 16 | 55.17 | WhatsApp communucation | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Sravya Kaavyaalu | 2020-05-19 | 14 | 12 | 85.71 | 12 | 85.71 | What's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Mosfet | 2020-05-19 | 30 | 25 | 83.33 | 25 | 83.33 | Lesson material shared through WhatsApp group | Click Here |
P Harshitha | Statistics | I B.Sc. | Geometric distribution | 2020-05-19 | 39 | 14 | 36 | 14 | 36 | Zoom application | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Sivaraju pattabishekam | 2020-05-19 | 17 | 17 | 100 | 17 | 100 | Class through zoom app and shared study material through WhatsApp | Click Here |
K.Venugopalarao | Commerce | I B.com | Planning in India | 2020-05-19 | 30 | 25 | 83.33 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Magnetostriction,Piezoelectric methods | 2020-05-19 | 70 | 15 | 21.4 | 15 | 21.4 | Webex meet | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cylinder | 2020-05-19 | 40 | 22 | 55 | 22 | 55 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-19 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | GUdipati Venkata Chalam | 2020-05-19 | 18 | 17 | 94 | 18 | 94 | shared material through Whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Hyperssensitivity type 1 | 2020-05-19 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson shared through whatsapp and discussed | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Hypersensitivity type 1 | 2020-05-19 | 13 | 11 | 84.6 | 11 | 84.6 | video lesson shared through whatsapp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Osmotic pressure colligative nature and its experimental determination | 2020-05-19 | 49 | 13 | 26.5 | 13 | 26.5 | Revising concepts through webex meeting and assignment submission through watsapp | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Gadya Kaavyaalu | 2020-05-18 | 14 | 12 | 85.71 | 12 | 85.71 | What's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Field effect transistor | 2020-05-18 | 30 | 25 | 83.33 | 25 | 83.33 | Lesson material shared through WhatsApp group | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of poisson distribution | 2020-05-18 | 39 | 12 | 31 | 12 | 31 | Zoom application | Click Here |
Shaik jubeda | Physics | II BSc(MPC&mpcs) | Optics Helium Neon laser | 2020-05-18 | 79 | 16 | 20.25 | 16 | 20.25 | Webex meet app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Depression in freezing Point and its experimental determination | 2020-05-18 | 49 | 12 | 28.6 | 12 | 28.6 | CiscoWebex and Watsapp | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | kathaanika Lakshanalu Mariyu Kavi Subramanya Sastry garu | 2020-05-18 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Sivaraju pattabishekam | 2020-05-18 | 17 | 6 | 35.29 | 6 | 35.29 | Class through zoom app | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Amplitude resonance velocity resonance | 2020-05-18 | 70 | 14 | 20 | 14 | 20 | Webex meet | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-18 | 28 | 10 | 35.71 | 8 | 28.57 | WebEx meet | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | immunology - Major histocompatability complex | 2020-05-18 | 26 | 22 | 84.6 | 18 | 69.23 | Discussion through Google duo | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cylinder | 2020-05-18 | 40 | 18 | 45 | 18 | 45 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-18 | 15 | 6 | 40 | 6 | 40 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Immunology-MHC | 2020-05-18 | 13 | 11 | 84.6 | 11 | 84.6 | WHATSAPP SHARING | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | IMC assignment | 2020-05-18 | 29 | 14 | 48.28 | 14 | 48.28 | Assignment assign by whatsap pro | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Anibaddha Kaavyaalu | 2020-05-17 | 14 | 14 | 100 | 14 | 100 | What's app group | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cylinder | 2020-05-17 | 40 | 21 | 53 | 21 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-17 | 15 | 7 | 47 | 7 | 47 | Zoom Video app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | kathaanika Upodgaatham | 2020-05-17 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Elevation in the Boiling Point | 2020-05-17 | 49 | 12 | 24.5 | 12 | 24.5 | Cisco Webex and Watsapp | Click Here |
P Harshitha | Statistics | I B.Sc. | Poisson distribution | 2020-05-17 | 39 | 9 | 24 | 9 | 39 | Zoom application | Click Here |
Dr.G.Padmini Devi | Diet therapy | II B.Sc Homescience | Cholecystitis and cholelithiasis | 2020-05-16 | 24 | 17 | 70 | 14 | 58 | Remedial class by whatsapp group | Click Here |
Dorka | Biochemistry | III BSc Biochem | Alzheimers | 2020-05-16 | 14 | 14 | 100 | 8 | 57 | Assignment through Google Classroom | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Anibaddha Kaavyaalu | 2020-05-16 | 14 | 12 | 85.71 | 12 | 85.71 | What's app group | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | ECOLOGY | 2020-05-16 | 22 | 17 | 77.12 | 17 | 77.12 | you tube links shared through whats app group | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Discus the model paper of aquaculture management | 2020-05-16 | 29 | 13 | 44.84 | 13 | 44.84 | Two online video classes by Google duo app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Vedam Venkata Raya Sastry | 2020-05-16 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp and conucted meeting through Go to meeting APP | Click Here |
K.Venugopalarao | Commerce | B.com banking | Negotiable instruments | 2020-05-16 | 30 | 25 | 83.33 | 20 | 66.67 | Material send to students through WhatsApp group | Click Here |
B.Swetha Rani Bai | Project | III B.Sc Home science | Bits preparation on nutrition | 2020-05-16 | 20 | 15 | 95 | 15 | 95 | Watsapp group | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Sivaraju pattabishekam | 2020-05-16 | 17 | 17 | 100 | 17 | 100 | Shared study material through WhatsApp group and video class through zoom app | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Different equation of forced harmonic oscillator | 2020-05-16 | 70 | 14 | 20 | 14 | 20 | Webex meet | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Samslista Vaakyam | 2020-05-16 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-PG Entrace practice paper IX-IMMUNODEFICIENCY | 2020-05-16 | 26 | 22 | 84.6 | 20 | 76.92 | Question paper shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance practice paper ix | 2020-05-16 | 13 | 11 | 84.6 | 11 | 84.6 | question paper shared through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cylinder | 2020-05-16 | 40 | 21 | 53 | 21 | 53 | Zoo Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-16 | 15 | 7 | 47 | 7 | 47 | Zoom Video app | Click Here |
D.Krishnapriya | General Psychology | III B.Sc Homescience | Emotional intelligence-domains and emotional competence | 2020-05-15 | 20 | 20 | 100 | 13 | 65 | Remedial class by whatsapp grpup | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Rasa Dhwani | 2020-05-15 | 14 | 12 | 85.71 | 12 | 85.71 | what's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Photo electric devices | 2020-05-15 | 30 | 25 | 83.33 | 25 | 83.33 | Lesson material shared through WhatsApp group | Click Here |
Shaik jubeda | Physics | II BSc(MPC&mpcs) | Optics Boys method | 2020-05-15 | 79 | 14 | 17.7 | 14 | 17.7 | Webex meet | Click Here |
M.Indiramma | English | I.BSc | Correction of sentence | 2020-05-15 | 25 | 9 | 36 | 7 | 28 | Zoom | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Paper 1 practical model paper discus | 2020-05-15 | 29 | 8 | 27.57 | 8 | 27.57 | Online video class by Google duo app | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Paper 1 practical model paper discus | 2020-05-15 | 29 | 8 | 27.57 | 8 | 27.57 | Online video class by Google duo app | Click Here |
P Harshitha | Statistics | I B.Sc. | Binomial distribution Limiting cases | 2020-05-15 | 39 | 10 | 26 | 10 | 26 | Zoom application | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Lowering of vapour pressure | 2020-05-15 | 49 | 12 | 24.5 | 12 | 24.5 | Webex and Watsapp | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Tirupati venkata kavulu naatakaalu | 2020-05-15 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
K.Venugopalarao | Commerce | II B.com | Business Law | 2020-05-15 | 30 | 26 | 86.67 | 25 | 83.33 | Material send to students through WhatsApp group | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cone | 2020-05-15 | 40 | 20 | 50 | 20 | 50 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Continuous Functions | 2020-05-15 | 15 | 6 | 40 | 6 | 40 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-PG Entrance practice paper VIII | 2020-05-15 | 26 | 22 | 84.6 | 20 | 76.92 | Question paper shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Immunology-PG Entrace practice paper VIII Vaccines | 2020-05-15 | 13 | 11 | 84.6 | 11 | 84.6 | whatsapp sharing and discussion | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | E-Commerce | 2020-05-15 | 26 | 26 | 100 | 26 | 100 | Google form | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-15 | 28 | 14 | 50 | 14 | 50 | WebEx meet | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Saamanya Vaakyam | 2020-05-15 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | Logic families | 2020-05-15 | 30 | 27 | 90 | 27 | 90 | Whatsapp material sharing | Click Here |
D.Krishna Priya | Resource management | III B.Sc Homescience | Types and steps in making time schedule | 2020-05-14 | 20 | 20 | 100 | 14 | 70 | Remedial class by whatsapp group | Click Here |
DrBDJ Satya latha | Zoology | Second yearc2 | Ecology | 2020-05-14 | 17 | 17 | 77.77 | 17 | 77.77 | Assignment topic given through WhatsApp group | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Alankaara Dhwani | 2020-05-14 | 14 | 14 | 100 | 14 | 100 | What's App group | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Tirupati venkata kavulu Kavi Parichayam | 2020-05-14 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
G.sita | Electronics | 1 BSC MECS | Photo electric devices | 2020-05-14 | 30 | 4 | 13.33 | 4 | 13.33 | Webex meet | Click Here |
K.Venugopalarao | Commerce | B.com | Banking and financial institutions quiz answers | 2020-05-14 | 20 | 20 | 100 | 20 | 100 | Answers shared through WhatsApp group | Click Here |
M.Indiramma | English | I.BSc | Remedial class | 2020-05-14 | 25 | 9 | 36 | 9 | 36 | Zoom app | Click Here |
Dr.Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Respiration-Krebs cycle | 2020-05-14 | 22 | 8 | 36.36 | 8 | 36.36 | Lecturer method through Zoom App | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Neethi sathakam dhairya paddathi | 2020-05-14 | 17 | 5 | 29.41 | 5 | 29.41 | Class through zoom app | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Logarithmic decrement,relaxation time quality factor | 2020-05-14 | 70 | 19 | 27.4 | 19 | 27.4 | Webex meet | Click Here |
Dr.K.Anita Kumari | Growth and development during life span | I B.Sc Home Science | Principles of growth and development | 2020-05-14 | 30 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cone | 2020-05-14 | 40 | 23 | 58 | 23 | 58 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-05-14 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Iodine deficiency disorders | 2020-05-14 | 22 | 16 | 70 | 16 | 70 | Remedial classes through watsapp group | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-14 | 28 | 10 | 35.71 | 10 | 35.71 | WebEx meet | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Saamanya Vaakyam | 2020-05-14 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | cytokines | 2020-05-14 | 13 | 11 | 84.6 | 11 | 84.6 | video presentation shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | cytokines | 2020-05-14 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing | Click Here |
Dr. VijayaBabu Koganti | Communicative English | IB.A CE | Tenses | 2020-05-14 | 5 | 5 | 100 | 5 | 100 | CLT worksheet teleconference | Click Here |
Dr. VijayaBabu Koganti | CSS English | B.A B.COM B.SC | Writing Resume and Cover Letter | 2020-05-14 | 42 | 42 | 100 | 42 | 100 | Google Classroom | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Dilute solutions | 2020-05-14 | 49 | 8 | 16.3 | 8 | 16.3 | Cisco webex and watsapp | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | PHP | 2020-05-14 | 26 | 26 | 100 | 26 | 100 | GoogleClassroom | Click Here |
Dorka | Biochemistry | I BSc Biochem | ATCase | 2020-05-13 | 22 | 13 | 59 | 9 | 40 | Assignment through Google classroom | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Vasthu Dhwani | 2020-05-13 | 14 | 14 | 100 | 14 | 100 | What's app group | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Types of vaccines | 2020-05-13 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson prepared and shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Types of vaccines | 2020-05-13 | 13 | 11 | 84.6 | 11 | 84.6 | video lesson shared through whatsapp | Click Here |
G.sita | Electronics | 1 BSC MECS | Transistor biasing methods | 2020-05-13 | 30 | 25 | 83.33 | 25 | 83.33 | Screen sharing through WhatsApp group | Click Here |
M Padmaja | Political Science | III BA | Globalization | 2020-05-13 | 16 | 12 | 75 | 12 | 75 | Globalization through whatsapp | Click Here |
DrBDJ Satya latha | Zoology | Second yearc2 | Physiology mcqs | 2020-05-13 | 22 | 17 | 81.83 | 17 | 81.83 | You tube links are shared through WhatsApp group | Click Here |
P Harshitha | Statistics | I B.Sc. | Properties of binomial distribution | 2020-05-13 | 39 | 14 | 36 | 14 | 36 | Zoom application | Click Here |
M.Indiramma | English | I.BSc | Remedial class | 2020-05-13 | 25 | 3 | 12 | 0 | 12 | Zoom | Click Here |
M.Kamala Karuna | chemistry | IB.Sc | liquid crystals | 2020-05-13 | 53 | 6 | 11.3 | 6 | 11.3 | explained topic with Webex meeting, sent the ppt through whatsapp | Click Here |
Shaik jubeda | Physics | II BSc(MPC&mpcs) | Optics Ruby Laser | 2020-05-13 | 79 | 15 | 18.98 | 15 | 18.98 | Webex MEET app | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Aquaculture econamics | 2020-05-13 | 29 | 13 | 44.83 | 13 | 44.83 | Two classes by Google duo app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Dharmavarapu Subramanyam maroo moodu natakaalu | 2020-05-13 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Paropakaara paddathi | 2020-05-13 | 17 | 3 | 17.64 | 3 | 17.64 | Class through zoom app | Click Here |
Prasanthi Danie | Physics | 1 BSC (MPC AND MPCS) | Different equation of damped harmonic oscillator | 2020-05-13 | 70 | 15 | 22.4 | 15 | 22.4 | Webex meet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year II Semester | गङ्गावतरणम् | 2020-05-13 | 10 | 8 | 80 | 8 | 80 | Zoom app | Click Here |
Dr.S.Priyanka | Biotechnology | II B.Sc | Immunology | 2020-05-13 | 8 | 4 | 50 | 4 | 50 | Whats up | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cone | 2020-05-13 | 40 | 22 | 55 | 22 | 55 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-05-13 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
Dr. Vijaya Babu Koganti | Communicative English PII | I B.A | Tenses | 2020-05-13 | 4 | 4 | 100 | 4 | 100 | CLT worksheet teleconference | Click Here |
Dr. Vijaya Babu Koganti | CSS | B.A/ B.Com/B.Sc | Writing Resume and Cover Letter | 2020-05-13 | 42 | 42 | 100 | 42 | 100 | Google Classroom | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | NMR spectroscopy | 2020-05-13 | 49 | 15 | 30.6 | 15 | 30.6 | Cisco Webex and Watsapp | Click Here |
Dr. N. Manjula Bharathi | Physics | III B. Sc(MPC) | Op. Amp | 2020-05-13 | 37 | 35 | 95 | 35 | 95 | Whatsapp material sharing | Click Here |
Dr.K.Anita Kumari | Training and HRD | III B.Sc Home science | Formulating objectives and characteristic | 2020-05-13 | 20 | 15 | 90 | 15 | 90 | Remedial classes through watsapp group | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Pigments present in fruits | 2020-05-13 | 30 | 10 | 80 | 10 | 80 | Remedial classes through watsapp group | Click Here |
K.Venugopalarao | Commerce | B.com banking | Banking and financial institutions quiz | 2020-05-13 | 20 | 20 | 100 | 20 | 100 | Quiz question bit bank shared through WhatsApp group | Click Here |
D Vijaya Sree | Biochemistry | II B4, B6 | Degradation of purines | 2020-05-13 | 15 | 4 | 26 | 4 | 26 | Remedial by whatsapp | Click Here |
D.Krishnapriya | Housing and Interior decoration | II B.Sc Homescience | Define fatigue write in detail about forms of fatigue | 2020-05-12 | 24 | 18 | 75 | 14 | 58 | Remedial class by whatsapp | Click Here |
Dr.G.Padmini Devi | Fundamentals of family nutrition | IB.Sc Homescience | Nutritional requirements and nutritional problems of school children | 2020-05-12 | 30 | 18 | 60 | 15 | 50 | Remedial class by whatsapp group | Click Here |
Dorka | Biochemistry | III BSc Biochem | Molecular Chaperones | 2020-05-12 | 14 | 14 | 100 | 6 | 43 | Assignment through Google Classroom | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Rasaabhaasamu | 2020-05-12 | 14 | 12 | 85.71 | 12 | 85.71 | Through What's App Group | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C1 B2 N B4 | PHYSIOLOGY | 2020-05-12 | 62 | 52 | 83.87 | 52 | 83.87 | YOUTUBE LINKS SHARED THROUGH WHATSAPP GROUP | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | ASSIGNMENTS COLLECTED | 2020-05-12 | 22 | 17 | 77.12 | 17 | 77.12 | WHATSAPP GROUP | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | M.Sc FINAL YR | FISH VACCINATION | 2020-05-12 | 17 | 17 | 100 | 17 | 100 | SLIDE SHARE SHARD THROUGH WHATSAPP GROUP | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year II Semester | पुष्पोद्भवचरितम्। | 2020-05-12 | 22 | 20 | 90 | 20 | 90 | Zoom app | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Bathruhari neethi sathakamu lo sujana paddathi | 2020-05-12 | 17 | 14 | 82.35 | 14 | 82.35 | Study Material shared through WhatsApp group | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Dharmavarapu Subramanyam moodu natakaalu | 2020-05-12 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp and conducted meeting on Go to meeting app | Click Here |
Dr.Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Respiration- Glycolysis | 2020-05-12 | 22 | 8 | 36.36 | 8 | 36.36 | Lecturer method through Zoom App | Click Here |
Dr. N. Manjula Bharathi | Physics | III B. Sc(MPC) | Op. Amp | 2020-05-12 | 37 | 9 | 24.3 | 9 | 24.3 | Webex meet screen sharing | Click Here |
N Rajya Lakshmi | Computer Science | III Bsc Cluster | online quiz in PHP | 2020-05-12 | 11 | 11 | 100 | 11 | 100 | Click Here | |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cone | 2020-05-12 | 40 | 22 | 55 | 22 | 55 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-05-12 | 15 | 7 | 47 | 7 | 47 | Zoom Video app | Click Here |
P Harshitha | Statistics | I B.Sc. | Binomial distribution | 2020-05-12 | 39 | 12 | 31 | 12 | 31 | Zoom | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Fisheries education | 2020-05-12 | 29 | 18 | 62 | 18 | 62 | Assignment assign and received by whatsapp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | NMR spectroscopy | 2020-05-12 | 49 | 12 | 24.5 | 12 | 24.5 | CiscowebEx and Watsapp | Click Here |
Dr. Vijaya Babu | CSS | B.A/B.COM/B.SC | Writing Resume and Cover Letter | 2020-05-12 | 42 | 42 | 100 | 42 | 100 | CLT- Google Classroom | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance General zoology | 2020-05-12 | 26 | 22 | 84.6 | 20 | 76.92 | whatsapp sharing and discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance General zoology | 2020-05-12 | 13 | 11 | 84.6 | 11 | 84.6 | Click Here | |
Prasanthi Daine | Physics | 1 BSC (MPC AND MPCS) | Transverse vibrations of bars | 2020-05-12 | 70 | 16 | 22.8 | 16 | 22.8 | Webex meet | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A CE | Tenses revision | 2020-05-12 | 4 | 4 | 100 | 4 | 100 | CLT worksheet teleconference | Click Here |
Dr.Vijaya Babu Koganti | CSS | B.A/ B.COM B.SC | Writing Resume and Cover Letter | 2020-05-12 | 42 | 42 | 100 | 42 | 100 | Google Classroom | Click Here |
G V S PRANAYANI DEVI | COMPUTER SCIENCE | CLOUD COMPUTING | Problem solving techniques in programming | 2020-05-12 | 22 | 6 | 27.27 | 6 | 27.27 | Zoom video app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Abhivyakthi Vadamu | 2020-05-11 | 14 | 14 | 100 | 14 | 100 | Through What's App Group | Click Here |
G.sita | Electronics | 1 BSC MECS | Relation between current amplification of BJT | 2020-05-11 | 30 | 25 | 83.33 | 25 | 83.33 | Screen sharing through WhatsApp group | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-05-11 | 39 | 12 | 31 | 12 | 31 | Zoom application | Click Here |
M PADMAJA | Political Science | I BA | Direct Democracy | 2020-05-11 | 25 | 15 | 60 | 15 | 60 | Study material given through whatsapp | Click Here |
Dr.Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Nitrogen mETABOLISM-bIological Nitrogen fixation | 2020-05-11 | 22 | 6 | 27.27 | 6 | 27.27 | Lecture method Zoom App | Click Here |
M venkataramana | commerce | III bcom | funds flow statement | 2020-05-11 | 30 | 15 | 50 | 15 | 50 | whats up group | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Dharmavarapu Krishnamaacharyulu Kaviparichayam | 2020-05-11 | 18 | 17 | 94 | 17 | 94 | lecture method through whatsapp meeting conducted through Go to meeting APP | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Fish marketing methods assignment | 2020-05-11 | 29 | 18 | 62 | 18 | 62 | WhatsApp information | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Telugu Vaakyam | 2020-05-11 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year II Semester | Vyakaranam | 2020-05-11 | 10 | 8 | 80 | 8 | 80 | Zoom app | Click Here |
N Rajya Lakshmi | Computer Science | II Bsc | data structures | 2020-05-11 | 26 | 26 | 100 | 26 | 100 | google class room & whats App | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Bathruhari neethi sathakamu | 2020-05-11 | 17 | 4 | 23.52 | 4 | 23.52 | Class through zoom app | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Iron deficiency anemia | 2020-05-11 | 22 | 6 | 18 | 6 | 18 | Remedial classes through watsapp group | Click Here |
K.Venugopalarao | Commerce | I B.com | Depreciation problem | 2020-05-11 | 30 | 25 | 83.33 | 25 | 83.33 | Problem given to students through WhatsApp group | Click Here |
Prasanthi Daine | Physics | 1 BSC (MPC AND MPCS) | Longitudinal vibrations of fixed fixed free free bars | 2020-05-11 | 70 | 14 | 20 | 14 | 20 | Webex meet | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cone | 2020-05-11 | 40 | 19 | 48 | 19 | 48 | Zoom Video ap | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-05-11 | 15 | 5 | 33 | 5 | 33 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-systamic autoimmune diseases | 2020-05-11 | 26 | 22 | 84.6 | 20 | 76.92 | video lesson and question paper shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Immunology-systamic autoimmune diseases | 2020-05-11 | 13 | 11 | 84.6 | 11 | 84.6 | Click Here | |
Dr.G.Padmini Devi | Apparel and Merchandising | III B.Sc Homescience | Elements and techniques of visual merchandising | 2020-05-11 | 20 | 20 | 100 | 15 | 75 | Remesial class by whatsapp | Click Here |
D Uma | Botany | I Bsc | Anamolous secondary growth | 2020-05-11 | 25 | 5 | 20 | 5 | 20 | PPT by zoom | Click Here |
Dr. Vijaya Babu Koganti | CSS | B.A/B.Com/B.Sc | Writing Resume and Cover Letter | 2020-05-11 | 39 | 39 | 100 | 39 | 100 | CLT GOOGLE CLASSROOM | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A CE | Tenses | 2020-05-11 | 4 | 4 | 100 | 4 | 100 | CLT worksheet teleconference | Click Here |
Dorka | Biochemistry | I BSc Biochem | Phosphorylation, Zymogen Activation | 2020-05-10 | 22 | 13 | 59 | 9 | 40 | Assignment through Google Classroom | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Bhukthivadamu | 2020-05-10 | 14 | 14 | 100 | 14 | 100 | Through What's app group | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Optics lasers | 2020-05-10 | 79 | 11 | 13.9 | 11 | 13.9 | Jitsi meet app | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Vemana sandarbhasahitha vyakhyalu | 2020-05-10 | 17 | 4 | 23.52 | 4 | 23.52 | Class through zoom app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Chemical shift and spin spin coupling | 2020-05-10 | 49 | 10 | 20.4 | 10 | 20.4 | Cisco Webex and Watsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cone | 2020-05-10 | 40 | 21 | 53 | 21 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-05-10 | 15 | 9 | 60 | 9 | 60 | Zoom Video app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Naatakam Upodgaatham | 2020-05-10 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp. Meeting conducted in Go to meeting app | Click Here |
Dr. VijayaBabu Koganti | CSS | B.A/B.COM/B.SC | Writing Resume and Cover Letter | 2020-05-10 | 36 | 36 | 100 | 36 | 100 | CLT GOOGLE CLASSROOM | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Kodavatiganti kutumba rao garu navalaaa visleshana | 2020-05-09 | 18 | 17 | 94 | 17 | 94 | lecture method through whatsapp meeting through go to meeting app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram -Anumithivadamu | 2020-05-09 | 14 | 14 | 100 | 14 | 100 | Through Whats app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Switch mode power supply | 2020-05-09 | 30 | 25 | 83.33 | 25 | 83.33 | Material shared through WhatsApp group | Click Here |
M.Indiramma | English | I.BSc | Remedial class | 2020-05-09 | 25 | 11 | 44 | 8 | 32 | Zoom app | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Fish marketing methods | 2020-05-09 | 29 | 13 | 44.84 | 13 | 44.84 | Two sessions video classes by Google duo app | Click Here |
Naga Prasanna. M | Zoology | III yr Aquaculture cluster | Advanced methods of fish preservation | 2020-05-09 | 29 | 5 | 14.47 | 5 | 14.47 | Remedial class through Google duo | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Vemana mooksha reethulu | 2020-05-09 | 17 | 5 | 29.41 | 5 | 29.41 | Class taken through zoom app | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year B. Com. II Semester | कृषिफलम् | 2020-05-09 | 10 | 9 | 90 | 9 | 90 | zoom app | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | Bussiness to Bussiness Models | 2020-05-09 | 26 | 9 | 35 | 9 | 35 | Click Here | |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Vibhakti Kriyanvayam | 2020-05-09 | 14 | 14 | 100 | 14 | 100 | Material through Whats App | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | current affairs for competative exams | 2020-05-09 | 26 | 22 | 84.6 | 20 | 76.92 | whasapp sharing and discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | current affairs for competative exams | 2020-05-09 | 13 | 11 | 84.6 | 11 | 84.6 | whatsapp sharing and discussion | Click Here |
B.Swetha Rani Bai | Project | III B.Sc Home science | MCQS on disease conditions symptoms | 2020-05-09 | 20 | 5 | 15 | 5 | 15 | Remedial classes through watsapp group | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-09 | 40 | 23 | 58 | 23 | 58 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-09 | 15 | 9 | 60 | 9 | 60 | Zoom Video app | Click Here |
Dr. Vijaya Babu Koganti | Communicative English PII | I B.A | Tenses | 2020-05-09 | 4 | 4 | 100 | 4 | 100 | CLT WORKSHEET TELECONFERENCE | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Revision of topics Chemistry of aminoacids and proteins | 2020-05-09 | 54 | 36 | 66 | 36 | 66 | Zoom whatsapp Google classroom | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Question papers | 2020-05-09 | 22 | 4 | 22.12 | 4 | 22.12 | Zoom | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-1 B2 B4 | Zoogeographic realms | 2020-05-09 | 62 | 52 | 89.66 | 52 | 89.66 | WhatsApp group YouTube links shared | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Principle of NMR spectroscopy | 2020-05-09 | 49 | 12 | 24.5 | 12 | 24.5 | Cisco webex and watsapp | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-05-09 | 39 | 17 | 44 | 17 | 44 | Zoom application | Click Here |
Prasanthi Daine | Physics | 1 BSC (MPC AND MPCS) | Velocity of longitudinal wave in a bar | 2020-05-09 | 70 | 16 | 22.8 | 16 | 22.8 | Webex meet | Click Here |
Dr.G.Padmini Devi | Diet therapy | II B.Sc Homescience | Liver cirrhosis | 2020-05-09 | 24 | 22 | 91.6 | 15 | 62.5 | Remedial class by whatsapp | Click Here |
Dr.G.Padmini Devi | Family meal management | I B.Sc Homescience | Nutritional requirements and problems of preschool children | 2020-05-09 | 30 | 20 | 66.6 | 15 | 50 | Remedial class by whatsapp group | Click Here |
G V S Pranayani Devi | COmputer Science | Cloud Computing | Problem Solving | 2020-05-09 | 22 | 6 | 27.27 | 6 | 27.27 | Zoom App | Click Here |
G.sita | Electronics | 1 BSC MECS | Half wave and full wave rectifier | 2020-05-08 | 30 | 4 | 13.33 | 2 | 6.67 | Webex meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Optics system matrix for the combination of thin lenses | 2020-05-08 | 79 | 19 | 24 | 19 | 24 | Jitsi meet app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | Flip flops | 2020-05-08 | 37 | 35 | 94 | 35 | 94 | Whatsapp material sharing | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-05-08 | 39 | 17 | 44 | 17 | 44 | Zoom application | Click Here |
M.Indiramma | English | I.BSc | Voice | 2020-05-08 | 25 | 9 | 36 | 9 | 36 | Zoom app | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Vemana kavitha reethulu | 2020-05-08 | 17 | 13 | 76.47 | 13 | 76.47 | Shared study material through WhatsApp group | Click Here |
Naga Prasanna. M | Zoology | III yr Aquaculture cluster | Traditional methods of preservation | 2020-05-08 | 29 | 4 | 44.4 | 4 | 44.4 | Remedial class through Google Duo | Click Here |
Dr. Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Mineral Nutition in plants | 2020-05-08 | 22 | 10 | 45.5 | 10 | 45.5 | Lecturer method through Zoom App | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Diagnosis and health management of fishes | 2020-05-08 | 29 | 15 | 51.78 | 15 | 51.78 | Two sessions online video classes by Google duo app | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Samapaka Asamapaka Kriyalu | 2020-05-08 | 14 | 14 | 100 | 14 | 100 | Material given through Whats App | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance-8-model exam | 2020-05-08 | 26 | 22 | 84.6 | 20 | 76.92 | question paper shared through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PGCET MATERIAL | 2020-05-08 | 13 | 11 | 84.6 | 11 | 84.6 | Material shaed through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-08 | 40 | 31 | 78 | 31 | 78 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A6 | The Plane | 2020-05-08 | 15 | 11 | 73 | 11 | 73 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-08 | 15 | 7 | 47 | 7 | 47 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Orthogonality | 2020-05-08 | 35 | 10 | 29 | 10 | 29 | Zoom Video app | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A CE | Tenses | 2020-05-08 | 5 | 5 | 100 | 5 | 100 | Participative through worksheet Teleconference | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Question papers | 2020-05-08 | 22 | 18 | 83.56 | 18 | 83.56 | Whatspp group YouTube links shared | Click Here |
Dr.K.Sucharita | Microbiology | IIIBSc | MSc entrance Transcription and translation | 2020-05-08 | 33 | 16 | 48 | 15 | 45 | Explanation through Zoom PPT sharing through whatsapp and Google classroom | Click Here |
Dorka | Biochemistry | III BSc Biochem | MALDI-ESI | 2020-05-08 | 14 | 14 | 100 | 5 | 36 | Assignment through Google Classroom | Click Here |
D.Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Ergonomics-aspects and principles | 2020-05-08 | 24 | 22 | 91.6 | 15 | 62.6 | Remedial class by whatsapp | Click Here |
D.Krishna priya | General Psychology | III B.Sc Homescience | Deviations of intelligence -subnormal and the gifted | 2020-05-08 | 20 | 20 | 100 | 15 | 75 | Remedial class by whatsapp | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Kodavatiganti kutumba rao garu | 2020-05-08 | 18 | 17 | 94 | 17 | 94 | shared lesson material through whatsapp | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Uthpatthi vadam | 2020-05-08 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's App Group | Click Here |
D Uma | Botany | III B5 | Gene transfer methods | 2020-05-07 | 9 | 5 | 56 | 5 | 56 | PPT, through zoom | Click Here |
D.Krishna Priya | Resource management | III B.Sc Homescience | Define timeplan.Write the steps in making timeplan | 2020-05-07 | 20 | 20 | 100 | 14 | 70 | Remedial class by whatsapp | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Vyabhichari bhavaalu | 2020-05-07 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's App group | Click Here |
M PADMAJA | Political Science | I BA | Democracy | 2020-05-07 | 25 | 15 | 60 | 15 | 60 | Study material shared through whatsapp | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Revision class carbohydrates | 2020-05-07 | 54 | 32 | 60 | 30 | 55 | Zoom PPT Whatsapp | Click Here |
Dr.K.Sucharita | Microbiology | IIIBSc | MSc entrance classification structure and functions of carbohydrates | 2020-05-07 | 33 | 16 | 48 | 16 | 48 | zoom whatsapp | Click Here |
G.sita | Electronics | 3 BSC MECS (CIUSTER) | Embedded system custom single purpose processor | 2020-05-07 | 11 | 10 | 90.91 | 10 | 90.91 | Notes given through WhatsApp | Click Here |
Dr.Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Plant physiology and metabolism-plant water relations-Enzymes | 2020-05-07 | 22 | 9 | 40.9 | 9 | 40.9 | Lecturer method through Zoom App | Click Here |
Naga Prasanna. M | Zoology | III yr Aquaculture cluster | Tips to identify freshness of fish and need of preservation | 2020-05-07 | 29 | 3 | 10.34 | 3 | 10.34 | Remedial class through WhatsApp | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Vemana hetuvadha drukpadham | 2020-05-07 | 17 | 6 | 35 | 6 | 35 | Class through zoom app | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year B. Com. II Semester | Vasistasrama gamanam | 2020-05-07 | 10 | 9 | 90 | 9 | 90 | Zoom app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Viswanadha Satyanarayana garu navala rachanalu | 2020-05-07 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Flip flops | 2020-05-07 | 67 | 9 | 13 | 9 | 13 | Webex meet screen sharing | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | revision of IR spectroscopy | 2020-05-07 | 49 | 11 | 22.4 | 11 | 22.4 | Seminar Presentation by Student and assignment through Cisco Webex Watsappp tools | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C1 B2 N B4 | PHYSIOLOGY AND ECOLOGY | 2020-05-07 | 62 | 52 | 83.87 | 52 | 83.87 | WHATSAPP YOUTUBE LINKS SHARED | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | PHYSIOLOGY AND ECOLOGY | 2020-05-07 | 22 | 17 | 81.82 | 17 | 81.82 | WHATSAPP YOUTUBE LINKS SHARED | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | M.Sc FINAL YR | FISH IMMUNOLOGY | 2020-05-07 | 17 | 17 | 100 | 17 | 100 | WHATSAPP SLIDESHARE SHARED | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Discus the department conducted covid quiz | 2020-05-07 | 29 | 13 | 44.84 | 13 | 44.84 | Two sessions online video class by Google duo app | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A6 | Right Line | 2020-05-07 | 15 | 10 | 67 | 10 | 67 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-07 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Inner Product Spaces | 2020-05-07 | 35 | 13 | 37 | 13 | 37 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance-basic concepts of zoology | 2020-05-07 | 26 | 22 | 84.6 | 20 | 76.92 | Google duo discussion | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance-basic concepts of zoology | 2020-05-07 | 13 | 11 | 84.6 | 11 | 84.6 | Click Here | |
Dr.Vijaya Babu Koganti | Communicative English | I B.A CE | Synonyms and Antonyms | 2020-05-07 | 5 | 5 | 100 | 5 | 100 | CLT THROUGH WORKSHEET | Click Here |
G V S Pranayani Devi | Cloud Computing | III BSC A8 | REST Integration Revision | 2020-05-06 | 22 | 6 | 27.27 | 6 | 27.27 | Zoom App | Click Here |
G Padmini Devi | Diet Therapy | II B.Sc Homescience | Types and process of dialysis | 2020-05-06 | 24 | 22 | 91.6 | 16 | 66.6 | Remedial class by whatsapp | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | II year | స్వయం ప్రవర్తన | 2020-05-06 | 11 | 9 | 81.8 | 9 | 81.8 | zoom app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Vibhaavaalu | 2020-05-06 | 14 | 12 | 85.71 | 12 | 85.71 | Lesson material shared through What's App group | Click Here |
G.sita | Electronics | 1 BSC MECS | Vi characteristics of diode | 2020-05-06 | 30 | 25 | 83.33 | 25 | 83.33 | Assignment through WhatsApp | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-05-06 | 39 | 15 | 49 | 15 | 49 | Zoom application | Click Here |
G.sita | Electronics | 3 BSC MECS (CIUSTER) | Instrumentation of measurement systems | 2020-05-06 | 11 | 3 | 27.27 | 3 | 27.27 | WhatsApp screen sharing | Click Here |
M.Indiramma | English | I.BSc | Verb forms | 2020-05-06 | 25 | 11 | 44 | 11 | 44 | Zoom app | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | MOSFET | 2020-05-06 | 30 | 4 | 13 | 4 | 13 | Webex meet screen sharing | Click Here |
M.Indiramma | English | II BA | Paragraph writing | 2020-05-06 | 28 | 23 | 82.14 | 23 | 82.14 | WebEx meet | Click Here |
Dr.Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Plant physiology and metabolism-plant water relations-Transpiration | 2020-05-06 | 22 | 11 | 50 | 11 | 50 | Lectuere method through Zoom App | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | Brute force attack and Encryption | 2020-05-06 | 22 | 4 | 18.18 | 4 | 18.18 | Hangouts video call and whatsapp group chat for assignments | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Vemana thaatveeka bhaavalu | 2020-05-06 | 17 | 5 | 29 | 5 | 29 | Class through zoom app | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A CE | Synonyms ans Antonyms | 2020-05-06 | 4 | 4 | 100 | 4 | 100 | Worksheet through CLT TELECONFERENCE | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Structure of modern Telugu, Purusha Bodhaka Pratyayalu | 2020-05-06 | 14 | 14 | 100 | 14 | 100 | Material given through Whats App | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Water and soil characteristics of culture ponds | 2020-05-06 | 29 | 10 | 34.48 | 10 | 34.48 | Two sessions online video classes by Google duo app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Viswanadha Satyanarayana garu kaviparichayam | 2020-05-06 | 18 | 17 | 94 | 17 | 94 | shared material through Whatsapp group conducted class on go to meeting app | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-06 | 40 | 26 | 65 | 26 | 65 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG -Entrance -blood and its components | 2020-05-06 | 26 | 22 | 84.6 | 20 | 76.92 | Click Here | |
G V Bhaskar | Mathematics | 1 year Section - A6 | Right Line | 2020-05-06 | 15 | 11 | 73 | 11 | 73 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-06 | 15 | 9 | 60 | 9 | 60 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance-7-blood and its components | 2020-05-06 | 13 | 11 | 84.6 | 11 | 84.6 | Click Here | |
Dr.B.D.J.Satyalatha | Zoology | C1, B2& B4 | Ecology and nutrient cycles | 2020-05-06 | 62 | 52 | 83.56 | 52 | 83.56 | WhatsApp Ppt shared | Click Here |
Dr.B.D.J.Satyalatha | Zoology | C2 | Nervous system | 2020-05-06 | 22 | 17 | 77.87 | 17 | 77.87 | Video lesson shared through WhatsApp group | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Different types of molecular vibrations in poly atomic molecules | 2020-05-06 | 49 | 10 | 20 | 10 | 20 | Cisco webex meet for revising and watsapp for submitting assignment | Click Here |
MADHU LATHA P | CHEMISTRY | 1 B.Sc | chemical bonding | 2020-05-06 | 33 | 19 | 57.58 | 19 | 57.58 | online video call | Click Here |
K.Venugopalarao | Commerce | II B.com | Law terminology quiz | 2020-05-06 | 30 | 25 | 83.33 | 25 | 83.33 | Quiz program conducted in WhatsApp | Click Here |
K.Venugopalarao | Commerce | I B.com | Financial accounting Depreciation | 2020-05-06 | 30 | 25 | 83.33 | 25 | 83.33 | Lecture material send through WhatsApp group | Click Here |
Dr.K.Anita Kumari | Training and HRD | III B.Sc Home science | Training methods | 2020-05-06 | 20 | 15 | 95 | 15 | 95 | Remedial classes through watsapp | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Fats and oils | 2020-05-06 | 30 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
Dorka | Biochemistry | III BSc Biochem | X-ray Crystallography | 2020-05-05 | 14 | 14 | 100 | 9 | 64 | Assignment through Google classroom | Click Here |
Dorka | Biochemistry | I BSc Biochem | PDH, LDH | 2020-05-05 | 22 | 12 | 58 | 10 | 45 | Assignment through Google Classroom | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Unnava Lakshmi Narayana Panthulu Garu | 2020-05-05 | 18 | 17 | 94 | 17 | 94 | shared material in whatsapp group | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Optics translation and refraction matrix | 2020-05-05 | 79 | 18 | 22.78 | 18 | 22.78 | Jitsi meet app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Arthopakshepakaalu | 2020-05-05 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
G.sita | Electronics | 1 BSC MECS | Diodes | 2020-05-05 | 30 | 25 | 83.33 | 25 | 83.33 | Shared material through WhatsApp group | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-05-05 | 39 | 14 | 40 | 14 | 40 | Zoom application | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | MOSFET | 2020-05-05 | 30 | 5 | 17 | 6 | 17 | Webex meet screen sharing | Click Here |
D.Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Read and write the following definitions 1.Define Ergonomics 2. Work triangle 3.Harmony 4.Rhythm 5.Prospect 6.House 5.Bonsai 6.R | 2020-05-05 | 24 | 22 | 91.6 | 18 | 75 | Remedial class by whatsapp | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C1 B2 N B4 | PHYSIOLOGY | 2020-05-05 | 62 | 57 | 91.12 | 57 | 91.12 | WHATSAPP ASSIGNMENT TOPIC SHARED | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | ECOLOGY | 2020-05-05 | 22 | 17 | 83.87 | 17 | 83.87 | WHATSAPP VIDEO LESSON AND YOUTUBE LINKS SHARED | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | M.Sc FINAL YR | FISH IMMUNOLOGY | 2020-05-05 | 17 | 17 | 100 | 17 | 100 | WHATSAPP SLIDE SHARE SHARED | Click Here |
M.Indiramma | English | I.BSc | Remedial class | 2020-05-05 | 25 | 13 | 52 | 13 | 52 | Zoom app | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-05 | 28 | 20 | 71.43 | 20 | 71.43 | WebEx meet | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year B. Com. II Semester | Krushiphalam | 2020-05-05 | 10 | 7 | 70 | 7 | 70 | Zoom app | Click Here |
Dr Chilaka Anitha | Telugu | 1 B.A (S.H.T) | Vemana kavitha reethulu | 2020-05-05 | 17 | 4 | 24 | 4 | 24 | Zoom app | Click Here |
Dr.G.Padmini Devi | Family meal management | I B.Sc Homescience | Nutritional composition of breast milk including colostrum | 2020-05-05 | 30 | 20 | 66.6 | 15 | 50 | Remedial class by whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance-6-endocrine system | 2020-05-05 | 26 | 22 | 84.6 | 18 | 69.23 | questionare through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance-6-endocrine system | 2020-05-05 | 13 | 11 | 84.6 | 11 | 84.6 | video lesson and question paper shared through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-05 | 40 | 29 | 73 | 29 | 73 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A6 | The Plane | 2020-05-05 | 15 | 12 | 80 | 12 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-05 | 15 | 8 | 83 | 8 | 83 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Basis and Dimension | 2020-05-05 | 35 | 11 | 31 | 11 | 31 | Zoom Video app | Click Here |
K.Venugopalarao | Commerce | I B.com | Consignment accounting | 2020-05-05 | 30 | 20 | 66.67 | 20 | 66.67 | Explanation through WhatsApp audio record and material send to students | Click Here |
K.Venugopalarao | Commerce | II B.com | Business Law | 2020-05-05 | 30 | 25 | 83.33 | 25 | 83.33 | Explanation through WhatsApp audio record and material send to students through WhatsApp group | Click Here |
Dr.Ch.Bhaskara Rao | Botany | II BSc,BZC (TM) | Plant physiology and metabolism-plant water relations | 2020-05-05 | 22 | 9 | 40.9 | 9 | 40.9 | Lecturer method through whats app | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Management of hatcheries | 2020-05-05 | 29 | 12 | 41.38 | 12 | 41.38 | Online video class by Google duo app | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Management of hatcheries | 2020-05-05 | 29 | 12 | 41.38 | 12 | 41.38 | Online video class by Google duo app | Click Here |
K.Venugopalarao | Commerce | I B.com | Bills of exchange | 2020-05-05 | 30 | 25 | 83.33 | 25 | 83.33 | Explanation through WhatsApp | Click Here |
K.Venugopalarao | Commerce | II B.com | Kinds of contracts | 2020-05-05 | 30 | 20 | 66.67 | 20 | 66.67 | Explanation through WhatsApp group | Click Here |
MADHU LATHA P | CHEMISTRY | 1 B.Sc | chemical bonding | 2020-05-05 | 33 | 13 | 39.39 | 13 | 39.39 | Whatsapp video chat | Click Here |
Naga Prasanna. M | Zoology | I yr M.Sc Zoology | Agorose gel electrophoresis and PAGE | 2020-05-05 | 25 | 25 | 100 | 25 | 100 | Video animations and video lectures through WhatsApp | Click Here |
Dr. Vijaya Babu Koganti | Communicative English P II | IB.A | Reading and Writing | 2020-05-05 | 5 | 5 | 100 | 5 | 100 | Google Classroom, Teleconference | Click Here |
PRSANTHI DANIE .S | PHYSICS | 1 B.Sc M.Pc and Mpcs | Principle of superposition of waves | 2020-05-05 | 70 | 15 | 21.43 | 15 | 21.43 | Video Lesson Through WebEx meet | Click Here |
Dr.K.Anita Kumari | Tie & dye | III B.Sc Home science | Stages of dyeing | 2020-05-05 | 20 | 15 | 95 | 15 | 95 | Remedial classes through watsapp group | Click Here |
Prasanthi Daine | Physics | 1 BSC (MPC AND MPCS) | Combination of two mutually perpendicular S.H.V's in ratio 2:1 | 2020-05-04 | 70 | 16 | 22.8 | 16 | 22.8 | Webex meet | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Dhwani Swarupam | 2020-05-04 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
Dr.Guntupalli Gowri | telugu | II B.A(S.H.T) | kandukuri veeresilingam panthulu | 2020-05-04 | 18 | 17 | 94 | 17 | 94 | material shared through whatsapp | Click Here |
M PADMAJA | Political Science | I BA | Revision of Judicial Review | 2020-05-04 | 21 | 11 | 52.38 | 11 | 52.38 | Doubts clarification through whatsapp | Click Here |
G.sita | Electronics | 1 BSC MECS | Common emitter configuration | 2020-05-04 | 30 | 2 | 6.67 | 2 | 6.67 | Webex meet | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | MOSFET | 2020-05-04 | 30 | 27 | 90 | 27 | 90 | Assignment through whatsapp- | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Ardhabodhaka Pratyayalu | 2020-05-04 | 14 | 14 | 100 | 14 | 100 | Material through Whats app | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Aquarium preparation and setting | 2020-05-04 | 29 | 14 | 48.28 | 14 | 48.28 | Material provided by whatsap | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-04 | 28 | 20 | 71.43 | 19 | 67.86 | Webex meet | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-04 | 28 | 20 | 71.43 | 19 | 67.86 | Webex meet | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-04 | 40 | 30 | 75 | 30 | 75 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A6 | Right Line | 2020-05-04 | 15 | 12 | 80 | 12 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-04 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Basis and Dimension | 2020-05-04 | 35 | 15 | 43 | 15 | 43 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | PG-Entrance-digestive system practice paper | 2020-05-04 | 26 | 22 | 84.6 | 20 | 76.92 | question through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | PG-Entrance practice paper-digestive system | 2020-05-04 | 13 | 11 | 84.6 | 11 | 84.6 | video lesson and questionare through wnatsapp | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Test conducted and doubt clarifications | 2020-05-04 | 54 | 30 | 55 | 30 | 55 | Zoom Whatsapp | Click Here |
Dr.K.Anita Kumari | Growth and development during life span | I B.Sc Home Science | Reflexes | 2020-05-04 | 30 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Clinical methods | 2020-05-04 | 22 | 20 | 98 | 20 | 98 | Remedial classes through watsapp group | Click Here |
Dr.G.Padmini Devi | Apparel and Merchandising | III B.Sc Homescience | Trends in retailing, sales promotion technique | 2020-05-04 | 20 | 20 | 100 | 14 | 70 | Remedial class by whatsapp | Click Here |
Naga Prasanna. M | Zoology | I yr M.Sc Zoology | Genomics | 2020-05-04 | 25 | 25 | 100 | 25 | 100 | Shared video lessons and material through WhatsApp | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Different regions in EMR and finger print region in IR | 2020-05-04 | 49 | 15 | 30.6 | 15 | 30.6 | Cisco webEx Virtual meeting | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | concepts of Chromophore Auxochrome and Effect of Conjugation | 2020-05-04 | 49 | 6 | 12.2 | 6 | 12.2 | Cisco Webex virtual meeting | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Clinical methods | 2020-05-04 | 22 | 15 | 85 | 15 | 85 | Remedial classes through watsapp group | Click Here |
Prasanthi Daine | Physics | 1 BSC (MPC AND MPCS) | Combination of two mutually perpendicular S.H.V's of equal frequencies | 2020-05-03 | 70 | 16 | 22.8 | 16 | 22.8 | Webex meet | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | OPTICS NODAL PLANES | 2020-05-03 | 79 | 21 | 26.58 | 21 | 26.58 | Jitsi meet app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - kaavya Bhedaalu(2) | 2020-05-03 | 14 | 14 | 100 | 14 | 100 | Shared material through What's app group | Click Here |
P Harshitha | Statistics | I B.Sc. | Theorems on Expectations | 2020-05-03 | 39 | 17 | 44 | 17 | 44 | Explanation of theorems Zoom application | Click Here |
Dr.Guntupalli Gowri | telugu | II B.A(S.H.T) | Navala lakshanalu | 2020-05-03 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-03 | 40 | 26 | 65 | 26 | 65 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A6 | Right Line | 2020-05-03 | 15 | 11 | 73 | 11 | 73 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-03 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Basis and Dimension | 2020-05-03 | 35 | 11 | 31 | 11 | 31 | Zoom Video app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Types of Electronic transitions in UVVis spectroscopy | 2020-05-03 | 49 | 11 | 22.45 | 11 | 22.45 | WebEx and Watsapp | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - kaavya Bhedaalu | 2020-05-02 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
Dr.Guntupalli Gowri | telugu | II B.A FOURTH SEM | Navala upodgaatham | 2020-05-02 | 18 | 18 | 100 | 18 | 100 | lecture method through whatsapp | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | Skill-oriented class for jobs | 2020-05-02 | 22 | 4 | 18.18 | 4 | 18.18 | Cisco Webex meeting. | Click Here |
Ramaraju E | Zoology | III B.SC-Aquaculture cluster | Quiz covid19 | 2020-05-02 | 29 | 17 | 58.62 | 17 | 58.62 | Two sessions online video class by Google duo app | Click Here |
M venkataramana | commerce | III bcom | marginal costing | 2020-05-02 | 30 | 20 | 66.67 | 20 | 66.67 | whatsup group video call | Click Here |
k venugopala rao | commerce | I bcom | bills of exchange | 2020-05-02 | 30 | 20 | 66.67 | 20 | 66.67 | material issue whats up group | Click Here |
k venugopala rao | commerce | IIBcom | contingent of contract | 2020-05-02 | 30 | 20 | 66.67 | 20 | 66.67 | material issue whats up group | Click Here |
MADHU LATHA P | CHEMISTRY | 1 B.Sc | stereo Chemistry - Gen Chem | 2020-05-02 | 33 | 23 | 69.7 | 21 | 63.64 | Interaction | Click Here |
PRSANTHI DANIE .S | PHYSICS | 1 B.Sc M.Pc and Mpcs | Compound Pendulum Torsional Pendulum | 2020-05-02 | 70 | 20 | 28.57 | 20 | 28.57 | Interaction | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Autoimmunity | 2020-05-02 | 26 | 22 | 84.6 | 20 | 76.92 | Discussion through whatsapp after sharing ppt | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C,Telugu Medium | Immunology-Autoimmunity | 2020-05-02 | 13 | 11 | 84.6 | 11 | 84.6 | discussion through whatsapp | Click Here |
Naga Prasanna. M | Zoology | III yr Aquaculture cluster | Principles of preservation | 2020-05-02 | 29 | 3 | 10.34 | 3 | 10.34 | Through WhatsApp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-02 | 40 | 25 | 63 | 25 | 63 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 1 year Section A 6 | Right Line | 2020-05-02 | 15 | 12 | 80 | 12 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Vector Spaces | 2020-05-02 | 35 | 16 | 46 | 16 | 46 | Zoom Video app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Types of spectroscopy | 2020-05-02 | 49 | 15 | 30.6 | 15 | 30.6 | Cisco webex for conducting class and Watsapp for assignment submission | Click Here |
Ch.Nagamalleswari | Economics | III BA HEP cluster | Rythubazars | 2020-05-02 | 15 | 12 | 80 | 12 | 80 | Explain the topic through whatsapp video call | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | Trade Cycle | 2020-05-02 | 26 | 15 | 57 | 15 | 57 | WhatsApp and Jitsi Meet App | Click Here |
N Rajya Lakshmi | Computer Science | II Bsc | Explain Types of Data Structures | 2020-05-02 | 30 | 30 | 100 | 100 | 100 | Whats App | Click Here |
N Rajya Lakshmi | Computer Science | III Bsc Cluster | Date and Time functions in PHP | 2020-05-02 | 11 | 8 | 70 | 8 | 70 | Click Here | |
B.Swetha Rani Bai | Food Science | III B.Sc Home science | Biochemical ranges | 2020-05-02 | 20 | 15 | 95 | 15 | 95 | Remedial classes through watsapp group | Click Here |
Dr.G.Padmini Devi | Diet therapy | II B.Sc Homescience | Read and write acute and chronic kidney failure. | 2020-05-02 | 24 | 22 | 91 | 18 | 75 | Remedial class by whatsapp | Click Here |
Dr.G.Padmini Devi | Family meal management | I B.Sc Homescience | Read and Write down the physiological changes and problems during pregnancy. | 2020-05-02 | 30 | 20 | 66.6 | 15 | 50 | Remedial class by whatsapp | Click Here |
Naga Prasanna. M | Zoology | III yr Aquaculture cluster | Principles of preservation | 2020-05-02 | 29 | 3 | 10.34 | 3 | 10.34 | Assignment through whatsapp | Click Here |
Dorka | Biochemistry | I BSc Biochem | Enzymes used in Diagnosis | 2020-05-01 | 22 | 22 | 100 | 12 | 54 | Assignment through Google Classroom | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Rasa Samkhya | 2020-05-01 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year II Semester | Vasishtasrama gamanam | 2020-05-01 | 29 | 26 | 90 | 26 | 100 | Zoom app | Click Here |
M PADMAJA | Political Science | I BA | Judicial Review | 2020-05-01 | 30 | 25 | 83.33 | 25 | 83.33 | Study material given through whatsapp from Google and YouTube links | Click Here |
M PADMAJA | Political Science | III BA | Environmental Pollution | 2020-05-01 | 14 | 10 | 71.43 | 10 | 71.43 | Study material given through whatsapp | Click Here |
Shaik jubeda | Physics | II BSc mpc and mpcs | Optics location of unit planes | 2020-05-01 | 79 | 21 | 26.58 | 21 | 26.58 | Jitsi meet app | Click Here |
P Harshitha | Statistics | I B.Sc. | Theorems on Expectations | 2020-05-01 | 39 | 17 | 44 | 17 | 44 | Zoom application | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC) | MOSFET | 2020-05-01 | 37 | 7 | 19 | 7 | 19 | Webex meet screen sharing | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | I st B.A (HISTORY) | GHAZNI INVASION IN INDIA | 2020-05-01 | 50 | 40 | 80 | 40 | 80 | ONLINE CLASS THROUGH GOOGLE DUO | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | I st B.A (TOURISM) | HISTORICAL SITES | 2020-05-01 | 22 | 18 | 80 | 18 | 80 | ONLINE LESSON THROUGH GOOGLE DUO | Click Here |
Ramaraju E | zoology | III BSc Aquaculture cluster | culture ponds | 2020-05-01 | 29 | 18 | 62.8 | 18 | 62.8 | two sessions conduct the online video class by google duo app | Click Here |
Dorka | Biochemistry | I & III BSc Biochem | Awareness on COVID | 2020-05-01 | 83 | 83 | 100 | 83 | 100 | Google classroom, Google forms, Whats app | Click Here |
M venkataramana | commerce | IIBcom | agreement | 2020-05-01 | 30 | 20 | 66.67 | 20 | 66.67 | material issued whatsup group | Click Here |
M.Indiramma | English | I.BSc | CSS | 2020-05-01 | 25 | 15 | 60 | 15 | 60 | Zoom app | Click Here |
M venkataramana | commerce | IIBcom | income tax | 2020-05-01 | 30 | 20 | 66.67 | 20 | 66.67 | material issue whats up group | Click Here |
M.Indiramma | English | II BA | CSS | 2020-05-01 | 28 | 28 | 100 | 28 | 100 | WebEx meet | Click Here |
k venugopala rao | commerce | IIBcom | conditions and warreties | 2020-05-01 | 30 | 20 | 66.67 | 20 | 66.67 | material issue whats up group | Click Here |
NAGA PRASANNA MEDA | Zoology | III AQUACULTURE CLUSTER | transport and storage of fresh fish | 2020-05-01 | 29 | 4 | 13.79 | 4 | 13.79 | Remedial class through jitsi amd whats app | Click Here |
k venugopala rao | commerce | I bcom | joint venture | 2020-05-01 | 30 | 20 | 66.67 | 20 | 66.67 | material issue whats up group | Click Here |
M venkataramana | commerce | III bcom | comparative statement | 2020-05-01 | 30 | 20 | 66.67 | 20 | 66.67 | whatsup video call | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Short answere assignment and properties of enzymes | 2020-05-01 | 54 | 34 | 63 | 34 | 63 | Screencastify and googleclass room, whatsapp | Click Here |
S.Venkateswara Rao | Physics | III B.Sc Physics Cluster | OPTICAL FIBER | 2020-05-01 | 14 | 13 | 93 | 13 | 100 | WHATS UP CALL | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Instrumentation and working principle of Double beam spectrophotometer | 2020-05-01 | 49 | 13 | 26.5 | 13 | 26.5 | Virtual presentation through Cisco Webex | Click Here |
N.Divyasri | Commerce | I B.com computers | Enterprise resource planning life cycle | 2020-05-01 | 30 | 20 | 66.67 | 17 | 56.67 | Explanation through zoom app | Click Here |
N.Divyasri | Commerce | III B.com General | Marketing of financial services Differences between products and services | 2020-05-01 | 30 | 25 | 83.3 | 25 | 83.3 | Explanation through zoom app | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | Salesforce Marketing and Sales-Error Checking | 2020-05-01 | 22 | 4 | 18.18 | 4 | 18.18 | Google Hangouts and Whatsapp group chat | Click Here |
R Bhaskara Rao | Chemistry | III B.Sc. (M.Z.C) | Cyclo Alkanes (for M.Sc. Chemistry Entrance Exam) | 2020-05-01 | 24 | 12 | 50 | 12 | 50 | Duo App | Click Here |
R Bhaskara Rao | Chemistry | III B.Sc. (M.Z.C) | Complex compounds | 2020-05-01 | 24 | 8 | 33.33 | 8 | 33.33 | Duo App | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C1 B2 N B4 | ECOLOGY | 2020-05-01 | 62 | 52 | 83.87 | 52 | 83.87 | WHATSAPP GROUP PPT SHARED | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | ECOLOGY | 2020-05-01 | 22 | 18 | 81.82 | 18 | 81.82 | WHATSAPP GROUP MCQS SHARED | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | M.Sc FINAL YR | FISH IMMUNOSTIMULANTS | 2020-05-01 | 17 | 17 | 100 | 17 | 100 | WHATSAPP GROUP SLIDE SHARE SHARED | Click Here |
D.Krishnapriya | General psychology | III B.Sc Homescience | Types of intelligence | 2020-05-01 | 20 | 12 | 60 | 7 | 35 | Remedial class by whatsapp | Click Here |
D.Krishnapriya | Housing and interior decoration | II B.Sc Homescience | Principles for table setting | 2020-05-01 | 24 | 15 | 62.5 | 10 | 41.6 | Remedial class by whatsapp | Click Here |
D Naga Chandrika | Psychology | II B.A(P.E.P) | aggression | 2020-05-01 | 14 | 8 | 57 | 8 | 57 | online test through whats app | Click Here |
D Uma | Bitany | III yr Botany | Transgenic plants | 2020-05-01 | 9 | 7 | 78 | 7 | 78 | Zoom cloud meeting | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Sphere | 2020-05-01 | 40 | 26 | 65 | 26 | 65 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 1 year Section A 6 | Right Line | 2020-05-01 | 15 | 11 | 73 | 11 | 73 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-05-01 | 15 | 7 | 47 | 7 | 47 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Vector Spaces | 2020-05-01 | 35 | 16 | 46 | 16 | 46 | Zoom Video app | Click Here |
Dr.Guntupalli Gowri | telugu | II B.A FOURTH SEM | Raayeprolu Subbarao | 2020-05-01 | 18 | 18 | 100 | 18 | 100 | lecture method through whatsapp | Click Here |
MADHU LATHA P | CHEMISTRY | 1 B.Sc | stereo Chemistry - Gen Chem | 2020-05-01 | 33 | 19 | 57.58 | 18 | 54.55 | Interaction | Click Here |
PRSANTHI DANIE .S | PHYSICS | 1 B.Sc M.Pc and Mpcs | Simple Harmonic Motion - Differencial Equation | 2020-05-01 | 70 | 25 | 35.71 | 25 | 35.71 | Interaction | Click Here |
Dr. Vijaya Babu Koganti | Communicative English PII | I B.A C.E | Reading and Writing | 2020-05-01 | 5 | 5 | 100 | 5 | 5 | Google Class room and Teleconference | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Rasa Raajamu | 2020-04-30 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through what's app group | Click Here |
N Rajya Lakshmi | Computer Science | III Bsc Cluster | php control statements | 2020-04-30 | 11 | 2 | 18 | 2 | 18 | Click Here | |
N Rajya Lakshmi | Computer Science | III BCom | e-commerce advantages | 2020-04-30 | 26 | 15 | 57 | 15 | 57 | Click Here | |
Dr N MANJULA BHARATHI | Physics | III B.Sc.(MPC) | MOSFET | 2020-04-30 | 37 | 7 | 19 | 7 | 19 | Webex meet screen sharing | Click Here |
Ramaraju E | zoology | III BSc Aquaculture cluster | management of carp culture | 2020-04-30 | 29 | 12 | 41.38 | 12 | 41.38 | online video class by google duo app-two sessions | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-04-30 | 39 | 19 | 49 | 19 | 49 | Zoom application | Click Here |
N.Divyasri | Commerce | I B.com General | Business environment | 2020-04-30 | 30 | 20 | 66.67 | 20 | 66.67 | Explanation through WhatsApp and material send to students through WhatsApp group | Click Here |
M.Indiramma | English | I.BSc | Remedial class | 2020-04-30 | 25 | 11 | 44 | 11 | 44 | Zoom app | Click Here |
M.Indiramma | English | II BA | CSS | 2020-04-30 | 28 | 18 | 64.29 | 18 | 64.29 | WebEx meet | Click Here |
Dr. prasanna Josphen | Economics | II B.A(H.E.P,C.E,P.E.P) | Inflation | 2020-04-30 | 52 | 20 | 38 | 20 | 38 | video lecture | Click Here |
k.venugopalarao | Commerce | First year bcom | Depreciation | 2020-04-30 | 30 | 20 | 66 | 20 | 66 | Material issued Whats up group | Click Here |
k.venugopalarao | Commerce | Second year B.com | Free content | 2020-04-30 | 30 | 20 | 66 | 20 | 66 | Material issued whats up group | Click Here |
M.venkataramana | Commerce | Final year B.com | Common size statement | 2020-04-30 | 30 | 20 | 66 | 20 | 66 | Whats up group message | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Monoclonal antibodies-PG-entrance model exam | 2020-04-30 | 26 | 21 | 80.7 | 18 | 69.23 | questionare through whatsapp | Click Here |
Dr.N.Ankamma | Zoology | M.Sc 11 year | Monoclonal antibodies | 2020-04-30 | 17 | 16 | 94 | 16 | 94 | video lesson presentation shared through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year Section - A3 | The Cylinder | 2020-04-30 | 40 | 35 | 88 | 35 | 88 | Zoom Video app | Click Here |
Dr. Vijaya Babu Koganti | Communicative English PII | IB.A CE | Stress identification | 2020-04-30 | 4 | 4 | 100 | 4 | 100 | Worksheet through CLT- Teleconference | Click Here |
D.Krishna Priya | Resource Management | III B.Sc Homescience | write about tools of time management | 2020-04-30 | 20 | 20 | 100 | 14 | 70 | Remedial class by whatsapp group | Click Here |
G V Bhaskar | Mathematics | 1 year Section A 6 | Right Line | 2020-04-30 | 15 | 9 | 60 | 9 | 60 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Vector Spaces | 2020-04-30 | 35 | 18 | 51 | 18 | 51 | Zoom Video app | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C1 B2 N B4 | PHYSIOLOGY | 2020-04-30 | 62 | 52 | 83.87 | 52 | 83.87 | Through whats app group MCQs paper is shared. Previous question paper answers were shared in whats app group and collected answe | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | BIO-GEP-CYCLES | 2020-04-30 | 22 | 5 | 28.23 | 5 | 28.23 | ZOOM | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | M.Sc FINAL YR | IMMUNIDIFFUSION | 2020-04-30 | 17 | 17 | 100 | 17 | 100 | WHATSAPP GROUP PPT SHARED | Click Here |
Dr CH.BHASKARA RAO | BOTANY | II BZC | PHOTO PHYSIOLOGY AND METOBOLISM AND PHOTOSYNTHOSIS | 2020-04-30 | 20 | 8 | 40 | 8 | 40 | LECTURE METHOD THROUGH WHATSAPP | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | III B.A (HISTORY CLUSTER) | PLANNING AND DEVELOPMENT OF AP TOURISM | 2020-04-30 | 11 | 11 | 100 | 11 | 100 | ONLINE CLASS THROUGH GOOGLE DUO | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | III B.A (TOURISM CLUSTER) | FORMS OF PACKAGE TOURS | 2020-04-30 | 11 | 11 | 100 | 11 | 100 | MATERIAL SENT THROUGH WHATSAPP | Click Here |
NAGA PRASANNA MEDA | Zoology | III AQUACULTURE CLUSTER | RIGOR MORTIS AND SPOILAGE | 2020-04-30 | 29 | 2 | 7 | 29 | 2 | Remedial class through jitsi app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Beer lamberts law | 2020-04-30 | 49 | 12 | 24.5 | 12 | 24.5 | Jitsi meet | Click Here |
D Naga Chandrika | Psychology | II B.A(P.E.P) | prejudice | 2020-04-30 | 14 | 6 | 40 | 6 | 40 | online test through whats app | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kodavatiganti Kutumba Rao | 2020-04-30 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1rv9KNFthQt1L_L_V-XZ2TZYUbpE1NmY6/view | Click Here |
Dr.Ch.Bhaskara Rao | Botany | 3rd BSC Botany Cluster paperI | Ethnobotany and medicinal Botany, plants used by tribal populations | 2020-04-30 | 25 | 10 | 40 | 10 | 10 | Lecturer method through Whts app | Click Here |
N Rajya Lakshmi | Computer Science | III BCom | PHP Operators and Data Types, E-Commerce Advantages | 2020-04-29 | 26 | 10 | 38 | 10 | 38 | WhatsApp and Jitsimeet App | Click Here |
P Harshitha | Statistics | I B.Sc. | Mathematical Expectations | 2020-04-29 | 39 | 19 | 49 | 19 | 49 | Zoom application | Click Here |
prasanna | Economics | I B.A | keynesian | 2020-04-29 | 8 | 4 | 50 | 4 | 50 | video | Click Here |
A.Sravani | Commerce | II B.Com(Banking) | Life Insurance Company | 2020-04-29 | 30 | 15 | 50 | 15 | 50 | video lecture | Click Here |
Dr.G.Padmini Devi | Diet therapy | II B.Sc Homescience | Write about Glomerulo nephritis and nephrosis | 2020-04-29 | 24 | 22 | 91.6 | 17 | 70.8 | Remedial class by whatsapp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kodavatiganti Kutumba Rao | 2020-04-29 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1rv9KNFthQt1L_L_V-XZ2TZYUbpE1NmY6/view | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - kaavya prayojanaalu | 2020-04-29 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through what's app group | Click Here |
M PADMAJA | Political Science | I BA | Powers and functions of the Judiciary | 2020-04-29 | 21 | 8 | 38.09 | 8 | 38.09 | Conference call and whattsapp | Click Here |
M PADMAJA | Political Science | III BA | Terrorism | 2020-04-29 | 14 | 6 | 42.85 | 6 | 42.85 | Material given through whatsapp | Click Here |
Shaik jubeda | Physics | II BSc mpc and mpcs | Optics matrix methods system matrix | 2020-04-29 | 79 | 16 | 20.25 | 16 | 20.25 | Jitsi app | Click Here |
k.venugopalarao | Commerce | First year bcom | Consignment | 2020-04-29 | 30 | 20 | 66 | 20 | 66 | Material issued whats up group | Click Here |
k.venugopalarao | Commerce | Second year B.com | Capacity to contract | 2020-04-29 | 30 | 20 | 66 | 20 | 66 | Material issued whats up group | Click Here |
M.venkataramana | Commerce | Final year B.com | Common size statement | 2020-04-29 | 30 | 20 | 66 | 20 | 66 | Whats up group video call | Click Here |
M.venkataramana | Commerce | Second year B.com | Income from House property | 2020-04-29 | 30 | 20 | 66 | 20 | 66 | Whats up group video call | Click Here |
M.venkataramana | Commerce | Second year B.com | Function of RBI | 2020-04-29 | 30 | 20 | 66 | 20 | 66 | Whats up group video call | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | FET | 2020-04-29 | 30 | 8 | 27 | 9 | 27 | Webex meet screen sharing | Click Here |
S.Venkateswara Rao | Physics | III B.Sc Physics Cluster | Advantages and Applications of optic fiber communication | 2020-04-29 | 4 | 4 | 100 | 4 | 100 | whats up messages | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | I st B.A (TTM) | CLIMATE CONDITIONS OF AP | 2020-04-29 | 22 | 18 | 81 | 18 | 81 | ONLINE CLASS THROUGH GOOGLE DUO | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | I st B.A (HISTORY) | PALLAVAS | 2020-04-29 | 50 | 40 | 80 | 40 | 80 | ONLINE CLASS THROUGH GOOGLE DUO | Click Here |
N.Divyasri | Commerce | III B.com General | Types of Audit | 2020-04-29 | 30 | 25 | 83 | 20 | 66.67 | Explanation through zoom app | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Sugars | 2020-04-29 | 30 | 22 | 92 | 22 | 92 | Remedial classes through watsapp group | Click Here |
DR. B D J SATYA LATHA | ZOOLOGY | II Yr. B.Sc | RESPIRATORY SYSTEM | 2020-04-29 | 62 | 52 | 83.67 | 52 | 83.67 | WHATSAPP GROUP | Click Here |
DR. B D J SATYA LATHA | ZOOLOGY | II Yr. B.Sc C2 | EXCRETORY SYSTEM | 2020-04-29 | 22 | 16 | 81.34 | 16 | 81.34 | WHATSAPP GROUP YOUTUBE LINKS SHARED | Click Here |
DR. B D J SATYA LATHA | ZOOLOGY | M. Sc FINAL YEAR | FISH IMMUNOLOGY | 2020-04-29 | 17 | 17 | 100 | 17 | 100 | WHATSAPP GROUP YOUTUBE LINKS SHARED | Click Here |
Dr.Vijaya Babu Koganti | Communicative English PII | CE I B.A | Stress identification | 2020-04-29 | 5 | 5 | 100 | 5 | 100 | Worksheet CLT Teleconference | Click Here |
Ramaraju E | zoology | III BSc Aquaculture cluster | aquafarms | 2020-04-29 | 29 | 14 | 48.28 | 14 | 48.28 | online video class by google duo app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Antigen antibody interactions | 2020-04-29 | 26 | 21 | 80.7 | 16 | 61.53 | Discussion method through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cylinder | 2020-04-29 | 40 | 34 | 85 | 34 | 85 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Differentiation | 2020-04-29 | 8 | 3 | 38 | 3 | 38 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Vector Spaces | 2020-04-29 | 35 | 22 | 63 | 22 | 63 | Zoom Video app | Click Here |
M.Indiramma | English | II BA | CSS | 2020-04-29 | 28 | 28 | 100 | 28 | 100 | WebEx meet | Click Here |
M.Indiramma | English | II BA | CSS | 2020-04-29 | 28 | 28 | 100 | 28 | 100 | WebEx meet | Click Here |
N Rajya Lakshmi | Computer Science | III Bsc Cluster | PHP Operators and control Statements | 2020-04-29 | 11 | 4 | 36 | 4 | 36 | Whatsapp Group | Click Here |
D Naga Chandrika | Psychology | II B.A(P.E.P) | prejudice | 2020-04-28 | 14 | 9 | 64 | 9 | 64 | remedial classes through whats app | Click Here |
D Naga Chandrika | Psychology | I B.A(P.E.P) | learning | 2020-04-28 | 20 | 10 | 50 | 10 | 50 | remedial class through whats app | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kodavatiganti Kutumba Rao | 2020-04-28 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1rv9KNFthQt1L_L_V-XZ2TZYUbpE1NmY6/view | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Kaavya hethuvulu | 2020-04-28 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
M.venkataramana | Commerce | Final year B.com | Management accounting and financial accounting | 2020-04-28 | 30 | 20 | 66 | 20 | 66 | Whats up video call and pdf | Click Here |
M.venkataramana | Commerce | Second year B.com | Residential status | 2020-04-28 | 30 | 20 | 66 | 20 | 66 | What's up video call and pdf | Click Here |
Dr N MANJULA BHARATHI | Physics | III B.Sc.(MPCs) | FET | 2020-04-28 | 30 | 9 | 30 | 9 | 30 | Webex meet screen sharing | Click Here |
Shaik Jubeda | Physics | II BSc mpc and mpcs | Fraunhoffer diffraction | 2020-04-28 | 79 | 13 | 16.4 | 13 | 100 | Screen sharing through Jitsi meet app | Click Here |
Ramaraju E | zoology | III BSc Aquaculture cluster | aquaculture basics and types | 2020-04-28 | 29 | 10 | 32.8 | 10 | 32.8 | on line video class by google duo app | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year II Semester | Krushiphalam | 2020-04-28 | 21 | 21 | 100 | 21 | 100 | Zoom app | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | I st B.A (HISTORY) | CHALUKYAS OF BADAMI | 2020-04-28 | 25 | 11 | 44 | 11 | 44 | I HAVE TAKEN AN ONLINE CLASS FOR I st B.A STUDENTS ON THE TOPIC CHALUKYAS OF BADAMI THROUGH GOOGLE DUO | Click Here |
Mekala.Indiramma | English | I.BSc-A6,A8 | Tenses Exercise | 2020-04-28 | 25 | 6 | 24 | 6 | 24 | Zoom app | Click Here |
N.Divyasri | Commerce | III B.com General | Introduction of Auditing | 2020-04-28 | 60 | 40 | 66.67 | 31 | 51 | Explanation through online Zoom app with pdf | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cylinder | 2020-04-28 | 40 | 29 | 73 | 29 | 73 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Vector Spaces | 2020-04-28 | 35 | 24 | 69 | 24 | 69 | Zoom Video app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Transport number and its determination by Hittorf's method | 2020-04-28 | 49 | 13 | 26.5 | 13 | 26.5 | Jitsi meet | Click Here |
Dr.B.D.J.Satyalatha | Zoology | C1, B2& B4 | Embryology | 2020-04-28 | 62 | 52 | 83.87 | 52 | 83.87 | WhatsApp group Exam conducted | Click Here |
Dr.B.D.J.Satyalatha | Zoology | C2 | Respiratory and circulatory systems | 2020-04-28 | 22 | 6 | 27.2 | 6 | 27.2 | Zoom | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Overview of the immune system-PG Entrance practice paper | 2020-04-28 | 26 | 21 | 80.7 | 18 | 69.23 | Questionare method | Click Here |
D.Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Read and write about significance of colour in interior decoration.Discuss any five colour harmonies | 2020-04-28 | 24 | 22 | 91.6 | 15 | 62.5 | Remedial class by whatsapp | Click Here |
Dr.G.Padmini Devi | Family Meal Management | I B.Sc Homescience | Write about nutritional requirements and eatung problems of adolescents | 2020-04-28 | 30 | 20 | 66.6 | 15 | 50 | Remedial class by whatsapp | Click Here |
NAGA PRASANNA MEDA | Zoology | I M.Sc Zoology | Tools and Techniques in Biology | 2020-04-28 | 25 | 25 | 100 | 25 | 100 | sHARED YOU TUBE VIDEO LINKS HROUGH WHATS APP | Click Here |
Dr. M. Hanumanth raju | Zoology | MSC final year | Vitamin deficiency diseases in fish and fish immunoglobulins | 2020-04-28 | 17 | 17 | 100 | 17 | 17 | WhatsApp YouTube links shared | Click Here |
Dr.B.D.J.Satyalatha | Zoology | MSC final year | Fish immunoglobulins | 2020-04-28 | 17 | 17 | 100 | 17 | 100 | WhatsApp YouTube links shared | Click Here |
k.venugopalarao | Commerce | First year bcom | Joint venture | 2020-04-28 | 30 | 20 | 66 | 20 | 66 | Material issued whats up group | Click Here |
k.venugopalarao | Commerce | Second year B.com | Remedies for breach of contract | 2020-04-28 | 30 | 20 | 66 | 20 | 66 | Material issued whats up group | Click Here |
D Vijaya Sree | Biochemistry | II B4, B6 | Denovo synthesis of purines | 2020-04-28 | 15 | 5 | 33 | 5 | 33 | Remedial class by whatsapp group | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Electro Chemistry Condoctometric titrations | 2020-04-28 | 49 | 7 | 14.3 | 7 | 14.3 | Google hangouts | Click Here |
G V S Pranayani Devi | Cloud computing | III BSC cloud computing | integration | 2020-04-27 | 22 | 12 | 54.5 | 12 | 54.5 | Google Hangouts Video Call | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kodavatiganti Kutumba Rao | 2020-04-27 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1rv9KNFthQt1L_L_V-XZ2TZYUbpE1NmY6/view | Click Here |
Ch.Nagamalleswari | Economics | III BA HEP cluster | Contract farming | 2020-04-27 | 15 | 12 | 80 | 12 | 80 | Explained the topic through whatsapp | Click Here |
Sk.Haseena | Economics | III BA FE | Kisa Credit Card Scheme | 2020-04-27 | 10 | 8 | 80 | 8 | 80 | Through the whatsapp video call | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Dasavidha rupakaalu | 2020-04-27 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through what's app group | Click Here |
M Padmaja | Political Science | I BA | Writs | 2020-04-27 | 21 | 6 | 28.57 | 6 | 100 | Doubts clarification through whatsapp and given notes through google and YouTube links | Click Here |
M PADMAJA | Political Science | III BA | World Trade organization | 2020-04-27 | 14 | 4 | 28.57 | 4 | 28.57 | Doubts clarification through whatsapp and given notes from google and YouTube links through whatsapp | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPCs) | FET | 2020-04-27 | 30 | 9 | 30 | 7 | 23 | Webex meet | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home science | Diet survey | 2020-04-27 | 22 | 19 | 96 | 15 | 85 | Remedial classes through watsapp group | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Quiz Topic revision Nutritional requirements of micro organisms and uptake of nutrients | 2020-04-27 | 54 | 37 | 66.8 | 36 | 66.8 | Google classroom and whatsapp | Click Here |
Ramaraju E | Zoology | III B.SC-C1 CLUSTER | Cluster paper three field record | 2020-04-27 | 12 | 6 | 50 | 6 | 50 | Online video class | Click Here |
M.Indiramma | English | I.BSc-A6,A8 | Remedial class--Prosd | 2020-04-27 | 25 | 9 | 36 | 6 | 24 | Zoom meeting | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | Configuration files and Ngrok | 2020-04-27 | 22 | 11 | 50 | 11 | 50 | Google hangouts and Whatsapp Group Chat | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Debye Huckel Onsagar's theory for strong electrolytes | 2020-04-27 | 49 | 13 | 26.5 | 13 | 26.5 | Jitsi app | Click Here |
Dr.K.Anita Kumari | Growth and development during life span | I B.Sc Home Science | Preschool | 2020-04-27 | 30 | 25 | 95 | 25 | 95 | Remedial classes through watsapp group | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-1 B2 B4 | Digestive system | 2020-04-27 | 62 | 52 | 86.16 | 52 | 86.16 | PowerPoint presentation sent through WhatsApp group | Click Here |
Dr.B.D.J.Satyalatha | Zoology | MSC | Lymphoid organs of fish | 2020-04-27 | 26 | 26 | 100 | 26 | 100 | WhatsApp Material shared | Click Here |
Dr.B.D.J.Satyalatha | Zoology | C2 | Digestive system | 2020-04-27 | 24 | 4 | 16.6 | 4 | 16.6 | Zoom | Click Here |
Dr.B.D.J.Satyalatha | Zoology | MSC | Fish pathology | 2020-04-27 | 26 | 26 | 100 | 26 | 100 | Material shared through WhatsApp group | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-27 | 20 | 16 | 80 | 16 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Vector Spaces | 2020-04-27 | 35 | 28 | 80 | 28 | 80 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Overview of the immune system | 2020-04-27 | 26 | 21 | 80.7 | 14 | 53.8 | Discussion method through video call | Click Here |
k.venugopalarao | Commerce | First year bcom | Consignment | 2020-04-27 | 30 | 15 | 50 | 12 | 40 | Whats up message | Click Here |
k.venugopalarao | Commerce | Second year B.com | Sale and agreement to sell | 2020-04-27 | 30 | 15 | 50 | 12 | 40 | Whats up message | Click Here |
NAGA PRASANNA MEDA | Zoology | I M.Sc Zoology | Tools and Techniques in Biology | 2020-04-27 | 25 | 25 | 100 | 25 | 25 | Youtube links on different types of chromatography and spectrophotometer and material was shared through Whats app group | Click Here |
Dr.G.Padmini Devi | Apparel and Merchandising | III Bmsc Homescience | Read and write about classification of Retailers | 2020-04-27 | 20 | 20 | 100 | 14 | 70 | Remedial class by whatsapp | Click Here |
Ch.Nagamalleswari | Economics | II BA FE | Kellyindex numbers | 2020-04-26 | 10 | 8 | 80 | 8 | 80 | Through the whatsapp video call | Click Here |
Ch.Nagamalleswari | Economics | III BA HEP | Organic farming | 2020-04-26 | 47 | 37 | 78 | 37 | 78 | Through the whatsapp | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Lalitha kalallo Kavithva sthaanam | 2020-04-26 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through what's app group | Click Here |
Shaik jubeda | Physics | II BSc(MPC&mpcs) | Optics Diffraction at straight edge | 2020-04-26 | 79 | 16 | 20.25 | 16 | 100 | JITSI MEET APP | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | Web servers and Database Servers | 2020-04-26 | 22 | 16 | 72.72 | 16 | 72.72 | Google Hangouts Video Call for explaining concepts and Whatsapp Group chat for assignments | Click Here |
Dr.B.D.J.Satyalatha | Zoology | C1, B2& B4 | Embryology | 2020-04-26 | 58 | 55 | 89.66 | 55 | 89.66 | WhatsApp group Revision test conducted | Click Here |
Dr.B.D.J.Satyalatha | Zoology | C2 | Embryology | 2020-04-26 | 22 | 18 | 81.56 | 18 | 81.56 | WhatsApp group Revision test conducted | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-26 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-04-26 | 8 | 3 | 38 | 3 | 38 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Matrix | 2020-04-26 | 30 | 22 | 73 | 22 | 73 | Zoom Video app | Click Here |
Dr Latha B | Chemistry | II BSc A1, B4, B6 | Electro Chemistry: Ostwald dilution law | 2020-04-26 | 49 | 15 | 30.6 | 15 | 30.6 | Jitsi meeting for conference and assignment submission through Watsapp | Click Here |
N.Divyasri | Commerce | I B.com computers | Enterprise resource planning | 2020-04-26 | 60 | 35 | 58.3 | 27 | 45 | Online Quiz program through WhatsApp and material send to students through WhatsApp group | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Electric and magnetic flux | 2020-04-26 | 75 | 42 | 56 | 42 | 56 | Cisco WebEx | Click Here |
Ch.Nagamalleswari | Economics | II BA FE | Fishers numbers | 2020-04-25 | 10 | 9 | 90 | 9 | 90 | Through whatsapp video call | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Rasa Nishta | 2020-04-25 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through what's app group | Click Here |
Sk.Haseena | Economics | IBA PEP | Classification of markets | 2020-04-25 | 20 | 6 | 30 | 6 | 30 | Explained the topic through whatsapp | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | User interface design, Styling | 2020-04-25 | 22 | 10 | 45.5 | 10 | 45.5 | Google Hangouts Video Call and Whatsapp chat for assignments | Click Here |
R Bhaskara Rao | Chemistry | III B.Sc. (M.Z.C) | Inductive Effect and its Applications (for MSC Chemistry Entrance Examination) | 2020-04-25 | 24 | 10 | 41.66 | 10 | 41.66 | Using Google Duo App | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC) | FET | 2020-04-25 | 37 | 9 | 24 | 9 | 24 | Screen sharing | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | III B.A (HISTORY CLUSTER) | BUDDIST MONUMENTS OF ANDHRA PRADESH | 2020-04-25 | 11 | 11 | 100 | 11 | 100 | SENT PPT THROUGH WHATSAPP GROUP | Click Here |
NAGA PRASANNA MEDA | Zoology | III MZC & BiZC | GLYCOLYSIS | 2020-04-25 | 25 | 6 | 24 | 6 | 24 | Remedial class through jitsi app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-classification and functions of antibodies | 2020-04-25 | 26 | 22 | 84.6 | 15 | 57.6 | Revision test conducted for 2marks questions by sharing question paper through whatsapp group. | Click Here |
Mekala.Indira | English | I.BSc | Remedial class | 2020-04-25 | 5 | 4 | 80 | 4 | 80 | Zoom | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A | Syllabification revision | 2020-04-25 | 3 | 3 | 100 | 3 | 100 | Worksheets through CLT METHOD TELECONFERENCEd | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-25 | 15 | 10 | 67 | 10 | 67 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-04-25 | 8 | 3 | 38 | 3 | 38 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Matrix | 2020-04-25 | 30 | 19 | 63 | 19 | 63 | Zoom Video app | Click Here |
Dr Latha B | Chemistry | II BSc MPC | Arrhenius theory for weak electrolytes | 2020-04-25 | 37 | 12 | 32.4 | 12 | 32.4 | Jitsi meet for Video conference | Click Here |
D Vijaya sree | Biochemistry | II B4, B6 | Lecithin metabolism | 2020-04-25 | 15 | 3 | 20 | 3 | 20 | Remedial class by whatsapp group | Click Here |
D Vijaya Sree | Biochemistry | III B4, B6 | Bioinformatics Pairwise alignment | 2020-04-25 | 6 | 9 | 56 | 9 | 56 | Remedial class by whatsapp group | Click Here |
k.venugopalarao | Commerce | Second year B.com | Valid contract | 2020-04-25 | 50 | 25 | 50 | 20 | 40 | Whats up messages and group message | Click Here |
P Harshitha | Statistics | III B.Sc. | Time series analysis | 2020-04-24 | 31 | 9 | 29 | 9 | 29 | Zoom application | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kodavatiganti Kutumba Rao | 2020-04-24 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1rv9KNFthQt1L_L_V-XZ2TZYUbpE1NmY6/view | Click Here |
Dr.K.Anita Kumari | Growth and development during life span | I B.Sc Home Science | Late childhood | 2020-04-24 | 30 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram - Rasa Swarupam | 2020-04-24 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through what's app group | Click Here |
D Vijaya Sree | Biochemistry | II B4, B6 | Beta oxidation | 2020-04-24 | 15 | 10 | 67 | 10 | 67 | Remedial class by whatsapp group | Click Here |
Mekala.Indiramma | English | I.BSc | On saying please | 2020-04-24 | 75 | 5 | 5 | 5 | 6 | Zoom | Click Here |
Mekala.Indiramma | English | I.BSc | On saying please | 2020-04-24 | 75 | 5 | 5 | 5 | 6 | Zoom | Click Here |
Naga Prasanna. M | Zoology | III MZC & BiZC | Carbohydrate class | 2020-04-24 | 25 | 2 | 8 | 2 | 8 | Remedial class through jitsi app | Click Here |
Deepthi Kancharla | Computer Science | III B.Sc. (Maths-Cloud-CS) | Salesforce Marketing and Sales-Email to case | 2020-04-24 | 22 | 16 | 72.7 | 16 | 72.7 | Google Hangouts Video Call | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A | Intonation III revision | 2020-04-24 | 3 | 3 | 100 | 3 | 100 | CLT Teleconference | Click Here |
Dr. N. Manjula Bharathi | Physics | III B. Sc(MPC) | FET | 2020-04-24 | 37 | 5 | 13 | 5 | 13 | Revision | Click Here |
Dr Latha B | Chemistry | II BSc MPC | Electrochemistry revision | 2020-04-24 | 35 | 11 | 31.4 | 11 | 31.4 | Virtual class through WebEx app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Structure of Antibody | 2020-04-24 | 26 | 22 | 84.6 | 16 | 72.7 | questionare and discussion method through whatsapp after sharing study material on the given topic. | Click Here |
Dr.B.D.J.Satyalatha | Zoology | II B.Sc C-2 | Types of eggs | 2020-04-24 | 26 | 15 | 57.35 | 15 | 57.35 | Whatsapp video call | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-24 | 15 | 12 | 80 | 12 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-04-24 | 8 | 3 | 38 | 3 | 38 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Linear Transformations | 2020-04-24 | 30 | 26 | 87 | 26 | 87 | Zoom Video app | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | I year II Semester | Vyakaranam | 2020-04-24 | 10 | 10 | 100 | 10 | 100 | Zoom app | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | III B.A (HISTORY CLUSTER) | TYPES OF TOURISM | 2020-04-24 | 11 | 11 | 100 | 11 | 100 | SENT PPT THROUGH WHATSAPP GROUP | Click Here |
CH.A.A.S.K.G.BHAVANI | HISTORY & TOURISM | III B.A (HISTORY CLUSTER) | ANDHRA CUISINE | 2020-04-24 | 11 | 11 | 100 | 11 | 100 | SENT PPT THROUGH WHATSAPP GROUP | Click Here |
Ch.Nagamalleswari | Economics | II BA FE | Index numbers | 2020-04-24 | 10 | 8 | 80 | 8 | 80 | Topic explained through the whatsapp | Click Here |
Sk.Haseena | Economics | I BA HEP | Ricardian rent theory | 2020-04-24 | 47 | 30 | 63 | 30 | 63 | Topic explained through whatsapp | Click Here |
D.Krishna Priya | General Psychology | III B.Sc Homescience | Nature and tests of intelligence | 2020-04-24 | 20 | 20 | 100 | 15 | 75 | Remedial class by whatsapp | Click Here |
D.Krishna Priya | Housing and interior decoration | II B.Sc Homescience | Art principles | 2020-04-24 | 24 | 22 | 91.67 | 17 | 70.83 | Remedial class by whatsapp | Click Here |
M.venkataramana | Commerce | Final year B.com | Marginal costing | 2020-04-24 | 50 | 20 | 40 | 15 | 30 | Metting was done in zoom app | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Quiz Revision of topics in measurement of growth | 2020-04-24 | 54 | 31 | 57.4 | 24 | 44.4 | Google classroom and whatsapp | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram- Paschaathya Alamkaarikulu | 2020-04-23 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC) | Doubts clearance | 2020-04-23 | 3 | 3 | 100 | 3 | 100 | Question and answer along with explanation | Click Here |
M Padmaja | Political Science | I BA | Parliamentary Government | 2020-04-23 | 21 | 6 | 28.57 | 5 | 23.8 | Doubts clarification through whatsapp | Click Here |
M Indiramma | English | I BSc | I'm not that woman | 2020-04-23 | 75 | 5 | 15 | 5 | 15 | Whatsapp group | Click Here |
Dorka | Biochemistry | III BSc | Awareness on COVID | 2020-04-23 | 26 | 26 | 100 | 26 | 100 | Google Classroom, Whats app, Google forms | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Anthropometric assessment | 2020-04-23 | 22 | 22 | 98 | 19 | 85 | Remedial classes through watsapp group | Click Here |
Dorka | Biochemistry | III BSc Biochem | Bt Cotton | 2020-04-23 | 16 | 16 | 100 | 12 | 75 | Google classroom | Click Here |
Dorka | Biochemistry | III BSc Biochem | Awareness on COVID | 2020-04-23 | 16 | 12 | 75 | 12 | 75 | Google Classroom, Google forms, Whats app | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C1 | GAMETOGENESIS | 2020-04-23 | 28 | 8 | 28.23 | 8 | 28.23 | ZOOM | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. C2 | FOETAL MEMBRANES | 2020-04-23 | 21 | 2 | 9.2 | 2 | 9.2 | WHATSAPP VIDEO CALL | Click Here |
Dr. B.D.J.SATYA LATHA | ZOOLOGY | II B.Sc. B2 B4 | PLACENTA | 2020-04-23 | 26 | 6 | 6.2 | 6 | 6.2 | ZOOM | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rachayithri Kanaparthi Lakshmamma | 2020-04-23 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1EFmFHlsOFmPgp6TITvgPrx7FE5Q1_PJ-/view | Click Here |
Dr Latha B | Chemistry | II BSc MPC | Spectrophotometry Revising Single and double beam spectrophotometry | 2020-04-23 | 35 | 15 | 42.8 | 10 | 28.6 | Virtual class through jitsi meet | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-23 | 15 | 8 | 53 | 8 | 53 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-04-23 | 8 | 4 | 50 | 4 | 50 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Linear Transformations | 2020-04-23 | 24 | 21 | 88 | 21 | 88 | Zoom Video app | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-Antigens | 2020-04-23 | 26 | 22 | 84.6 | 18 | 81.8 | Discussion method through Whatsapp and conducted exam on 2 -marks questions | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A | Intonation | 2020-04-23 | 3 | 3 | 100 | 3 | 100 | Worksheet through CLT - Teleconference | Click Here |
Dr.K.Anita Kumari | Growth and development during life span | I B.Sc Home Science | Late childhood | 2020-04-23 | 30 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
D Vijaya Sree | Biochemistry | II B4, B6 | Photophosphorylation | 2020-04-23 | 15 | 10 | 67 | 10 | 67 | Remedial class by whatsapp group | Click Here |
R Bhaskara Rao | Chemistry | III B.Sc. (M.Z.C) | M.Sc. Entrance Exam Coaching | 2020-04-23 | 24 | 12 | 50 | 12 | 50 | Using Google Duo app | Click Here |
D.Krishna Priya | Resource Management | III B.Sc Homescience | Time demands in stages of family life cycle | 2020-04-23 | 20 | 20 | 100 | 14 | 70 | Remedial class through whatsapp | Click Here |
A. Sravani | Commerce | ll. B. Com | Banking account | 2020-04-23 | 50 | 20 | 30 | 20 | 30 | Vio | Click Here |
N Rajya Lakshmi | Computer Science | III Bsc Cluster | PHP Operators and control Statements | 2020-04-23 | 11 | 4 | 36 | 4 | 36 | Click Here | |
Dr Vijaya Babu Koganti | Communicative English PII | I B.A | Intonation | 2020-04-22 | 4 | 4 | 100 | 4 | 100 | CLT - Tele Conference | Click Here |
Shaik Jubeda | Physics | II BSC MPC & MPCS | Fresnel half period zones | 2020-04-22 | 8 | 7 | 87.5 | 7 | 87.5 | JITSI APP | Click Here |
Dr Latha B | Chemistry | II BSc MPC | Spectrophotometry Laws of Absorption | 2020-04-22 | 35 | 8 | 22.8 | 8 | 22.8 | Conducted Virtual class through Jitsi meet | Click Here |
Dr.G.Padmini Devi | Diet Therapy | II B.Sc Home science | Classification of theraupetic and hospital diets | 2020-04-22 | 24 | 22 | 91.6 | 17 | 77.2 | Remedial class through whatsapp | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-22 | 15 | 9 | 60 | 9 | 60 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Riemann Integration | 2020-04-22 | 8 | 3 | 38 | 3 | 38 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Linear Transformations | 2020-04-22 | 24 | 15 | 63 | 15 | 63 | Zoom Video app | Click Here |
Dr.K.Anitha Kumari | Training and HRD | III B.sc Homescience | 1.Explain the role of training 2.what are steps involved in designing and conducting training. Explain in detail | 2020-04-22 | 20 | 20 | 100 | 16 | 80 | Remedial class through whatsapp group | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram | 2020-04-22 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
D Vijaya Sree | Biochemistry | II BE, B6 | Glycolysis and Krebs cycke | 2020-04-22 | 15 | 12 | 80 | 12 | 80 | Remedial class by whatsapp group | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Fermented and unfermented foods of milk products & milk processing | 2020-04-22 | 20 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Fermented and unfermented foods of milk products & milk processing | 2020-04-22 | 20 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rachayithri Kanaparthi Lakshmamma | 2020-04-22 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1EFmFHlsOFmPgp6TITvgPrx7FE5Q1_PJ-/view | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rachayithri Kanaparthi Lakshmamma | 2020-04-22 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1EFmFHlsOFmPgp6TITvgPrx7FE5Q1_PJ-/view | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Organs of immune system | 2020-04-22 | 26 | 22 | 84.6 | 12 | 46.15 | Discussion through whatsapp and conducted MCQ exam for PG-Entrance. | Click Here |
Dr. Vijaya Babu Koganti | Communicative English | I B.A | Brain Storming and Mind Mapping | 2020-04-21 | 2 | 2 | 100 | 2 | 100 | Communicative Language Teaching. | Click Here |
D Vijaya Sree | Biochemistry | II B4, B6 | Glycogen metabolism, HMP shunt | 2020-04-21 | 15 | 9 | 60 | 7 | 46 | Remedial class through Whatsapp group | Click Here |
D.Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Art elements | 2020-04-21 | 24 | 22 | 91.6 | 17 | 77.2 | Remedial class through whatsapp | Click Here |
Dr.G.Padmini Devi | Family meal management | I B.Sc Homescience | Nutritional requirements of pregnant and lactating women | 2020-04-21 | 30 | 20 | 66.6 | 16 | 80 | Remedial class through whatsapp group | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-21 | 15 | 7 | 47 | 7 | 47 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Sequences | 2020-04-21 | 8 | 3 | 38 | 3 | 38 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Linear Transformations | 2020-04-21 | 24 | 15 | 63 | 15 | 63 | Zoom Video app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram | 2020-04-21 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
Dorka | Biochemistry | I BSc | Amino acids Part - 1 | 2020-04-21 | 26 | 13 | 50 | 13 | 50 | Youtube Video lesson prepared by me | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rachayitri Kanaparthi Lakshminarayana | 2020-04-21 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/1EFmFHlsOFmPgp6TITvgPrx7FE5Q1_PJ-/view | Click Here |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Cells of immune system | 2020-04-21 | 26 | 22 | 84.6 | 15 | 57.6 | Discussion through whatsapp and conducted exam for PG entrance | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Microbial growth | 2020-04-21 | 54 | 29 | 53 | 29 | 53 | Whatsapp and google classroom | Click Here |
Dr. Vijaya Babu,Koganti | Communicative English | I B.A | Articles and Prepositions | 2020-04-20 | 3 | 2 | 67 | 2 | 100 | CLT - Teleconference | Click Here |
D Vijaya Sree | Biochemistry | III B4, B6 | Bioinformatics File formats | 2020-04-20 | 16 | 15 | 93 | 12 | 75 | Remedial class by whatsapp group, screenshots of different file formats of the protein of their interest were sent | Click Here |
Shaik.Jubeda | Physics | II BSC MPC & MPCS | Michelson Interferometer | 2020-04-20 | 8 | 8 | 100 | 8 | 100 | JITSI Video App | Click Here |
Dr.G.Padmini Devi | Apparel and Merchandising | IIIB.sc Homescience | Planning process and adding value to supply chain | 2020-04-20 | 20 | 20 | 100 | 15 | 75 | Remedial class in whatsapp group | Click Here |
Dr.K.Anitha Kumari | Growth and development during lifespan | I B.sc Homescience | 1.Characteristics of adolescents -Discuss 2.Explain parenting styles and their impact on personality 3.Define puberty and writ | 2020-04-20 | 30 | 20 | 66.66 | 16 | 80 | Remedial class through whatsapp group | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram | 2020-04-20 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
Ch.Nagamalleswari | Economics | III BA HEP | Regulated markets | 2020-04-20 | 10 | 4 | 40 | 4 | 100 | Through whatsapp video call | Click Here |
Dorka | Biochemistry | III BSc | PCR | 2020-04-20 | 16 | 12 | 100 | 75 | 75 | Google classroom | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Viswanadha Satyanarayana gari kavi parichayam | 2020-04-20 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1As71e-2MEGFwKux5Pl3VP6y2bz4qVvYA/view?usp=s | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | All definitions of community nutrition | 2020-04-20 | 22 | 15 | 85 | 15 | 85 | Remedial classes through watsapp group | Click Here |
Ch.Nagamalleswari | Economics | III BA HEP cluster | Regulated markets | 2020-04-20 | 15 | 10 | 66 | 10 | 60 | Explain the topic through whatsapp | Click Here |
Dr.K.Sucharita | Microbiology | I BSc | Discussion about assignment of work and doubt clarifications | 2020-04-20 | 54 | 26 | 48 | 24 | 42 | Zoom app and whatsapp | Click Here |
Shaik.Jubeda | Physics | II BSC MPC & MPCS | Newtons Rings | 2020-04-19 | 5 | 5 | 100 | 5 | 100 | JITSI Video App | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram | 2020-04-19 | 14 | 14 | 100 | 14 | 100 | Lesson material shared through What's app group | Click Here |
D Vijaya Sree | Biochemistry | III B4, B6 | Biological databases | 2020-04-18 | 16 | 13 | 81 | 12 | 75 | Remedial class by whatsapp group | Click Here |
G V Bhaskar | Mathematics | 1 year | The Cone | 2020-04-18 | 15 | 12 | 80 | 12 | 80 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Sequences | 2020-04-18 | 8 | 4 | 50 | 4 | 50 | Zoom Video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Orthogonality | 2020-04-18 | 24 | 20 | 83 | 20 | 83 | Zoom Video app | Click Here |
Dr. N. Vijayalakshmi | Telugu | III B.A (S.H.T) | Alankaara saasthram | 2020-04-18 | 14 | 14 | 100 | 14 | 100 | Lesson material and instructions given through whatsapp group | Click Here |
B.Swetha Rani Bai | Project | III B.Sc Home science | Preparation of objective type questions on nutrition | 2020-04-18 | 20 | 19 | 99 | 19 | 99 | Remedial classes through watsapp | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Cooking methods | 2020-04-18 | 30 | 20 | 90 | 20 | 90 | Remedial classes through watsapp group | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home Science | Iodine deficiency disorders | 2020-04-18 | 22 | 15 | 70 | 15 | 70 | Remedial classes through watsapp group | Click Here |
G V Bhaskar | Mathematics | 1 year | The Sphere | 2020-04-17 | 15 | 13 | 87 | 13 | 87 | Zoom video app | Click Here |
G V Bhaskar | Mathematics | 2 year | Sequences | 2020-04-17 | 8 | 4 | 50 | 4 | 50 | Zoom video app | Click Here |
G V Bhaskar | Mathematics | 3 year | Orthogonality | 2020-04-17 | 24 | 21 | 88 | 21 | 88 | Zoom video app | Click Here |
D Krishna Priya | General Psychology | III B.Sc Homescience | Characteristics of a counsellor and counselling process | 2020-04-17 | 20 | 20 | 100 | 15 | 75 | Remedial class through whatsapp group | Click Here |
D krishna Priya | Housing and Interior Decoration | II B.Sc Home Science | 1.Types of furniture 2. Factors to be considered while selection and arranging the furniture | 2020-04-17 | 24 | 22 | 91.6 | 16 | 72.7 | Remedial class through Whats app group | Click Here |
Dr.G.Padmini Devi | Family Meal Management | I B.Sc Homescience | Definitions | 2020-04-17 | 30 | 20 | 66.6 | 16 | 80 | Remedial class through whatsapp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Viswanadha Satyanarayana gari kavi parichayam | 2020-04-17 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1As71e-2MEGFwKux5Pl3VP6y2bz4qVvYA/view?usp=s | Click Here |
D Krishna Priya | Resource Management | III B.Sc Home science | Mundal's classes of change | 2020-04-16 | 20 | 20 | 100 | 15 | 75 | Remedial class through Whatsapp | Click Here |
Dr.K.Anitha Kumari | Growth and development during lifespan | I B.Sc Homescience | 1.Explain cognitive development during adolescence period 2. Discuss social development during adolescence period 3. Writ | 2020-04-16 | 30 | 20 | 66.66 | 15 | 75 | Remedial class through whatsapp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Viswanadha Satyanarayana gari kavi parichayam | 2020-04-16 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1As71e-2MEGFwKux5Pl3VP6y2bz4qVvYA/view?usp=s | Click Here |
Dr. N. Manjula Bharathi | Physics | III B.Sc.(MPC), III B.Sc.(mpcs) | Virtual lab..AND,OR,NOT gates | 2020-04-16 | 75 | 55 | 73 | 55 | 73 | Google classroom | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home science | 1.PEM 2.Vitamin-A deficiency 3.Food adulteration | 2020-04-16 | 22 | 20 | 98 | 20 | 98 | Remedial classes through watsapp group | Click Here |
Dr.Vijaya Babu Koganti | Communicative English | I B.A | Sentence Corrections | 2020-04-15 | 3 | 2 | 67 | 2 | 2 | Communicative Language Teaching | Click Here |
Dr.G.Padmini Devi | Diet Therapy | II B.Sc Homescience | Atherosclerosis mechanism and Dietary management | 2020-04-15 | 24 | 22 | 91.6 | 15 | 68.1 | Remedial class through whatsapp group | Click Here |
Dr.K.Anitha Kumari | Training and HRD | III B.Sc Homescience | 1. Explain need and outcomes of HRD 2. Write the concept of HRD 3.What are the functions of HRD 4.Explain the goals of HRD | 2020-04-15 | 20 | 20 | 100 | 16 | 80 | Remedial class through whatsapp group | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Different methods of parboiling & Food additives | 2020-04-15 | 19 | 13 | 75 | 19 | 70 | Remedial classes through watsapp group | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Viswanadha Satyanarayana gari kavi parichayam | 2020-04-15 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1As71e-2MEGFwKux5Pl3VP6y2bz4qVvYA/view?usp=s | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Different methods of parboiling & Food additives,rigor mortis | 2020-04-15 | 30 | 20 | 90 | 15 | 85 | Remedial classes through watsapp group | Click Here |
D.Krishna Priya | Housing and Interior Decoration | II B.Sc Homescience | Types of Accessories,Furniture and Furnishings | 2020-04-14 | 24 | 22 | 91.6 | 15 | 68.1 | Remedial class through whatsapp | Click Here |
Dr.G.Padmini Devi | Family Meal Management | I B.Sc Homescience | 1.Geriatric nutrition 2.Dietary modifications needed in old age and problems of old age | 2020-04-14 | 30 | 20 | 66.6 | 16 | 80 | Remedial class through whatsapp group | Click Here |
Dr.K.Anitha Kumari | Tie and Dye | IIIB.Sc Homescience | 1. Mention the types of fastness tests and write each test procedure in detail | 2020-04-14 | 20 | 20 | 100 | 15 | 75 | Remedial class through whatsapp | Click Here |
Dr.Koganti Vijaya Babu | Communicative English | I year | Error Analysis | 2020-04-13 | 3 | 2 | 67 | 2 | 100 | A worksheet was shared in advance and during the whatsapp class, the teacher elicited the answers and discussed the wrong ones w | Click Here |
Dr.G.Padmini Devi | Apparel and Merchandising | III B.Sc Homescience | Supply chain management definition and drivers of supply chain | 2020-04-13 | 20 | 20 | 100 | 15 | 75 | Remedial class through whatsapp group | Click Here |
Dr.K.Anitha Kumari | Growth and Development during Lifespan | I B.Sc Homescience | 1.Define Identity and explain the process of identity development in adolescence period. 2. Discuss identity crisis among adole | 2020-04-13 | 30 | 20 | 66.6 | 16 | 80 | Remedial class through whatsappgroup | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Unnava Lakshmi Narayana Panthulu Garu | 2020-04-13 | 18 | 17 | 94 | 17 | 17 | Online class and study material circulated through WhatsApp https://drive.google.com/file/d/126uLaHjnH3Im5zKDHS2_x85cm8BLl_oc/v | Click Here |
B.Swetha Rani Bai | Food Science | I B.Sc Home Science | Pigments present in fruits and vegetables | 2020-04-13 | 30 | 25 | 95 | 25 | 95 | Remedial classes through watsapp group | Click Here |
B.Swetha Rani Bai | Community Nutrition | II B.Sc Home science | Role of national and international organizations promoting health and nutrition | 2020-04-13 | 22 | 20 | 95 | 20 | 95 | Remedial classes through watsapp group | Click Here |
B.Vijaya rekha | Zoology | M.Sc final | nutritional types of microorganisms | 2020-04-12 | 25 | 9 | 36 | 9 | 36 | google meet | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Unnava Lakshmi Narayana Panthulu Garu | 2020-04-10 | 18 | 17 | 94 | 17 | 17 | Online class and study material circulated through WhatsApp https://drive.google.com/file/d/126uLaHjnH3Im5zKDHS2_x85cm8BLl_oc/v | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Unnava Lakshmi Narayana Panthulu Garu | 2020-04-09 | 18 | 17 | 94 | 17 | 17 | Online class and study material circulated through WhatsApp https://drive.google.com/file/d/126uLaHjnH3Im5zKDHS2_x85cm8BLl_oc/v | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Unnava Lakshmi Narayana Panthulu Garu | 2020-04-08 | 18 | 17 | 94 | 17 | 17 | Online class and study material circulated through WhatsApp https://drive.google.com/file/d/126uLaHjnH3Im5zKDHS2_x85cm8BLl_oc/v | Click Here |
Dorka | Biochemistry | I BSc | Amino acids Part - 2 | 2020-04-06 | 26 | 13 | 50 | 13 | 50 | Video lecture through You tube | Click Here |
G V S Pranayani Devi | Cloud COmputing | III BSC A8 | Partner WSDL | 2020-04-05 | 7 | 22 | 32.81 | 7 | 32.81 | Zoom App | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kandukuri Veeresilingam Panthulu | 2020-04-03 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/17zoBrHrcyH2Sr5zQ0NRw8D0I2VlIlA8x/view | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kandukuri Veeresilingam Panthulu | 2020-04-01 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp https://drive.google.com/file/d/17zoBrHrcyH2Sr5zQ0NRw8D0I2VlIlA8x/view | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Kandukuri Veeresilingam Panthulu | 2020-03-29 | 18 | 17 | 94 | 17 | 17 | Online class, study material circulated through WhatsApp | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Lakshanalu | 2020-03-28 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Lakshanalu | 2020-03-27 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Lakshanalu | 2020-03-27 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Lakshanalu | 2020-03-26 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Lakshanalu | 2020-03-26 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Upodhgatham | 2020-03-25 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Upodhgatham | 2020-03-22 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Navala Upodhgatham | 2020-03-21 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp https://drive.google.com/file/d/1YNKsnH3uKwGc_fwzIOTlt_z97PBSS2DL/view?usp=s | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rayaprolu Subba Rao | 2020-03-20 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rayaprolu Subba Rao | 2020-03-19 | 18 | 17 | 94 | 17 | 17 | Online class, material circulated through WhatsApp. | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rayaprolu Subba Rao | 2020-03-18 | 18 | 17 | 94 | 17 | 17 | Online classes, material circulated through WhatsApp | Click Here |
Dr. Guntupalli Gowri | Telugu | II BA (S.H.T) IVth Sem | Rayaprolu Subba Rao | 2020-03-15 | 18 | 17 | 94 | 17 | 17 | Online class and material circulated through WhatsApp | Click Here |
NAGA PRASANNA MEDA | Zoology | I M.Sc Zoology | Tools and Techniques in Biology | 2020-00-26 | 25 | 25 | 100 | 25 | 25 | Shared ppt and HPLC youtube link through Whats app group | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | RNA | 2019-11-20 | 20 | 13 | 65 | 13 | 13 | Lecture method | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | RNA | 2019-11-20 | 20 | 13 | 65 | 13 | 13 | Lecture method | Click Here |
Dr.Ch.Bhaskara Rao | Botany | 3 rd BSC,BZC -C1 Section | DNA Structure | 2019-11-20 | 40 | 15 | 39.47 | 15 | 39.47 | Lecture method | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | quantum yield of a photochemical reactions | 2014-08-20 | 70 | 21 | 30 | 21 | 30 | zoom app | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Assignment exam | 2013-09-20 | 77 | 6 | 7.8 | 6 | 7.8 | Webex app and Google Classroom | Click Here |
SHAIK JUBEDA | PHYSICS | II BSc mpc and mpcs | Assignment exam | 2013-09-20 | 77 | 6 | 7.8 | 6 | 7.8 | Webex app and Google Classroom | Click Here |
M.Kamala Karuna | chemistry | IB.Sc | bond order and bond energies | 2011-05-20 | 53 | 3 | 7 | 3 | 7 | lecture method through,webex meet | Click Here |
M.Kamala Karuna | chemistry | IB.Sc | bond order and bond energies | 2011-05-20 | 53 | 3 | 7 | 3 | 7 | lecture method through,webex meet | Click Here |
M.Kamala Karuna | chemistry | IB.Sc | MO THEORY | 2009-05-20 | 53 | 9 | 16 | 9 | 16 | webex meet ,explined thruogh shared document | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home science | Dietetic principles | 0202-09-14 | 23 | 13 | 60 | 13 | 60 | Zoom web meetings | Click Here |
M.Kamala Karuna | chemistry | III B.Sc | photo chemistry | 0005-08-20 | 45 | 27 | 60 | 27 | 27 | zoom app | Click Here |
DR.HANUMANTHARAJU | ZOOLOGY | BSC 1ST YEAR | BIRD MIGRATION | 0000-00-00 | 30 | 15 | 50 | 15 | 50 | POWER POINT PRESENTATION IN WHATSAPP GROUP | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Chromosomes | 0000-00-00 | 28 | 13 | 47 | 13 | 47 | Google meet lecture method with ppt | Click Here |
Kuchipudi Sujatha | Chemistry | II Bsc C2 | spectroscopy | 0000-00-00 | 9 | 23 | 39 | 9 | 39.1 | Whatsapp video call | Click Here |
D. Krishna Priya | Home | II bsc | Housing and interior decoration quiz | 0000-00-00 | 28 | 20 | 71 | 20 | 71 | Google form | Click Here |
Dorka | Biochemistry | III BSc Biochem | Molecular Biology | 0000-00-00 | 18 | 15 | 83 | 15 | 83 | Syllabus Circulation & writng by students through Whats app | Click Here |
Dorka | Biochemistry | III BSc Biochem | Introduction to Molecular Biology | 0000-00-00 | 18 | 14 | 78 | 14 | 78 | Molecular Biology Lecture - Discussion | Click Here |
Anusha K | Chemistry | III sem B.Sc | Metal carbonyls Ferrocene | 0000-00-00 | 49 | 35 | 71 | 35 | 71 | googlemeet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Metal carbonyls | 0000-00-00 | 49 | 28 | 57 | 28 | 57 | google meet | Click Here |
Dorka | Biochemistry | III BSc Biochem | Introduction to Molecular Biology | 0000-00-00 | 18 | 14 | 78 | 14 | 78 | Lecture Discussion in Google meet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Metal carbonyls | 0000-00-00 | 49 | 28 | 57 | 28 | 57 | googlemeet | Click Here |
Anusha K | Chemistry | III sem B.Sc | Metal carbonyls | 0000-00-00 | 49 | 28 | 57 | 28 | 57 | goglemeet | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Financial services Demat services | 0000-00-00 | 30 | 25 | 83.33 | 25 | 83.33 | Material sent to the students through the whatsapp Groups | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (General) | Financial services Demat services | 0000-00-00 | 30 | 25 | 83.33 | 25 | 83.33 | Material sent to the students through the whatsapp Groups | Click Here |
Dr. g.padmini devi | Homescience | III B.Sc. H.sc | types of communication | 0000-00-00 | 23 | 16 | 69.57 | 16 | 69.57 | zoom | Click Here |
Dr. g.padmini devi | Homescience | III B.Sc. H.sc | types of communication | 0000-00-00 | 23 | 16 | 69.57 | 16 | 69.57 | zoom | Click Here |
Dr.Gowri Guntupalli | Telugu | II B.A(S.H.T) | Rachayathri Kanaparthi varalakshmi | 0000-00-00 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Asravani | Commerce | III B. Com (com&b@bank) | Introduce cost accounting | 0000-00-00 | 50 | 20 | 40 | 20 | 40 | Webex meet | Click Here |
A. Sravani | Commerce | III B. Com (com&b@bank) | Cost sheet | 0000-00-00 | 70 | 31 | 40 | 31 | 40 | Webex meet | Click Here |
DR.HANUMANTHARAJU | ZOOLOGY | BSC 1ST YEAR | PARENTAL CARE IN AMIPHIBIA | 0000-00-00 | 30 | 15 | 50 | 15 | 50 | PPT IN WHTASAPP GROUP | Click Here |
DR.HANUMANTHARAJU | ZOOLOGY | BSC 1ST YEAR | IMPORTANT QUESTIONS AND SUBMISSION OF ASSIGNMENTS | 0000-00-00 | 60 | 30 | 50 | 30 | 50 | WHATSAPP GROUP | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Structure of modern Telugu, syntax | 0000-00-00 | 14 | 14 | 100 | 14 | 100 | Whats app video call | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A | Philips curve | 0000-00-00 | 34 | 20 | 58 | 20 | 58 | online class through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | I B.A(F.E) | investment function | 0000-00-00 | 8 | 4 | 50 | 4 | 50 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | I B.A(F.E) | Marginal Efficiency of capital | 0000-00-00 | 8 | 7 | 87 | 7 | 87 | revision through whats app | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Madhuraanthakam Raja ram | 0000-00-00 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A(C.E) | Philips curve | 0000-00-00 | 8 | 6 | 75 | 6 | 75 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | III B.A(F.E) | Financial Market in india | 0000-00-00 | 8 | 5 | 65 | 5 | 65 | online revision classes through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | I B.Com(computers) | Micro Economics and Macro Economics | 0000-00-00 | 60 | 6 | 1 | 6 | 1 | online revision through whats app | Click Here |
Dr S L B SANKARA SARMA | Sanskrit | III Semester | Vyakaranam | 0000-00-00 | 35 | 35 | 100 | 34 | 97 | Cisco Webex | Click Here |
Dr.Guntupalli Gowri | Telugu | II B.A(S.H.T) | Madhuraanthakam Raja ram | 0000-00-00 | 18 | 17 | 94 | 17 | 94 | shared material through whatsapp | Click Here |
N. BHAGYA RAJU | Commerce | III Bcom (Banking &computers) | MARKETING Product Branding and it's types | 0000-00-00 | 30 | 27 | 90 | 27 | 90 | Ppts sent to students through the whatsApp groups | Click Here |
B.Sucharitha | Chemistry | M.SC;2nd year | Methods to determine reaction mechanism of free radicals | 0000-00-00 | 13 | 4 | 31 | 4 | 31 | lecture method using zoom app | Click Here |
Devarapalli Uma | Botany | III BSC B5 | Transgenic Plants | 0000-00-00 | 9 | 7 | 77.8 | 7 | 77.8 | Video lesson / ppt | Click Here |
G.sita | Electronics | 1 BSC MECS | Power supplies | 0000-00-00 | 30 | 4 | 13.3 | 4 | 13.3 | Webex meet | Click Here |
G.sita | Electronics | 3 BSC MECS (CIUSTER) | Embedded system | 0000-00-00 | 11 | 3 | 27.2 | 3 | 27.2 | Webex meet | Click Here |
G.sita | Electronics | 1 BSC MECS | Diodes | 0000-00-00 | 30 | 4 | 13.3 | 4 | 13.3 | Webex meet | Click Here |
G.sita | Electronics | 1 BSC MECS | Bipolar junction transistor | 0000-00-00 | 30 | 3 | 10 | 3 | 10 | Webex meet | Click Here |
G.sita | Electronics | 3 BSC MECS (CIUSTER) | Instructions of 8085 microprocessor | 0000-00-00 | 11 | 3 | 27.2 | 3 | 27.2 | Click Here | |
Dr.N.Ankamma | Zoology | 111B.Sc,B.Z.C | Immunology-monoclonal antibodies revision and doughts clarification for PG Entrance | 0000-00-00 | 26 | 22 | 84.6 | 20 | 79 | video call through google duo | Click Here |
Dr. Ch.Bhaskara Rao | Botany | III B.Sc, Botany cluster paperI | Ethnobotany and medicinalBotany- Gloriosa plant description | 0000-00-00 | 25 | 11 | 44 | 11 | 44 | Lecturer method through Whats app | Click Here |
Dr.G.Swarna Latha | Telugu | 3rd BASHT | Structure of modern Telugu, syntax | 0000-00-00 | 14 | 14 | 100 | 14 | 100 | Material through Whats app | Click Here |
Shaik Jubeda | Physics | II BSc mpc and mpcs | Zone plate | 0000-00-00 | 16 | 16 | 100 | 16 | 100 | JITSI MEET APP | Click Here |
D krishnapriya | Homescience | III B.Sc Resource management | Management process | 0000-00-00 | 20 | 10 | 50 | 9 | 45 | Google classroom | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel deviations | 0000-00-00 | 38 | 23 | 60 | 23 | 60 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel deviations | 0000-00-00 | 38 | 23 | 60 | 23 | 60 | Google meet | Click Here |
Dr Vijaya Babu Koganti | English | Communicative English III Unit II | Describing People and Places | 0000-00-00 | 8 | 8 | 100 | 8 | 100 | CLT - Elicitation and Discussion | Click Here |
Y.Nagarathnamma | Botany | II Bzc(TM) | Prokaryotes | 0000-00-00 | 35 | 15 | 42 | 15 | 42 | ZOOM CLASS | Click Here |
Y.Nagarathnamma | Botany | II Bzc(TM) | Bryophytes | 0000-00-00 | 35 | 10 | 35 | 10 | 35 | ZOOM CLASS | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | Genetic material | 0000-00-00 | 16 | 8 | 50 | 8 | 50 | ZOOM CLASS | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | Taxonomy introduction | 0000-00-00 | 16 | 10 | 62.5 | 8 | 50 | ZOOM CLASS | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel deviations | 0000-00-00 | 38 | 24 | 68 | 24 | 65 | Google meet | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel deviations | 0000-00-00 | 38 | 24 | 65 | 24 | 65 | Google meet | Click Here |
G.sita | Electronics | 1 BSC MECS | Photo electric devices | 0000-00-00 | 30 | 4 | 13.33 | 4 | 13.33 | Webex meet | Click Here |
G.sita | Electronics | 1 BSC MECS | Photo electric devices | 0000-00-00 | 30 | 4 | 13.33 | 4 | 13.33 | Webex meet | Click Here |
Sravani | Commerce | III B.Com(gen) | Brack even analysis | 0000-00-00 | 50 | 30 | 60 | 30 | 60 | revision using whats app | Click Here |
Sravani | Commerce | II B.Com(Banking) and II B.Com(gen) | Bank Accounts | 0000-00-00 | 70 | 30 | 40 | 30 | 40 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | I B.A(F.E) | investment multiplier | 0000-00-00 | 8 | 7 | 87 | 7 | 87 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | I B.A(F.E) | economic growth and development | 0000-00-00 | 8 | 7 | 87 | 7 | 87 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A(H.E.P) | public finance | 0000-00-00 | 34 | 20 | 59 | 20 | 59 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A(H.E.P) | public goods and private goods | 0000-00-00 | 34 | 11 | 32 | 11 | 32 | revision through whats app | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | Chromosome structure | 0000-00-00 | 22 | 15 | 73 | 15 | 73 | Lecture method with relevant topics pictures sharing with zoom app | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A(P.E.P) | credit control of RBI | 0000-00-00 | 11 | 6 | 55 | 6 | 55 | revision through whats app | Click Here |
Y.Nagarathnamma | Botany | III BZC(TM) | Chromatid | 0000-00-00 | 20 | 10 | 50 | 10 | 50 | Lecture method through pictures | Click Here |
Dr. R.Prasanna Josphen | Economics | III B.A(F.E) | Exim policy in inndia | 0000-00-00 | 8 | 6 | 75 | 6 | 75 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A(H.E.P) | types of budget deficit | 0000-00-00 | 34 | 12 | 35 | 12 | 35 | revision classes through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | II B.A(C.E) | functions of commercial bank | 0000-00-00 | 8 | 7 | 8 | 7 | 88 | revision through whats app | Click Here |
Dr. R.Prasanna Josphen | Economics | I B.A(F.E) | history of five years plan in indian economy | 0000-00-00 | 8 | 7 | 88 | 7 | 88 | revision through whats app | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Techniques to determine mechanism of a Chemical Reaction | 0000-00-00 | 13 | 6 | 46 | 6 | 46 | zoom app screen sharing Lecture method | Click Here |
B.Sucharitha | Chemistry | M.SC II Year | Techniques to determine mechanism of a Chemical Reaction | 0000-00-00 | 13 | 6 | 46 | 6 | 46 | zoomapp screen sharing----Lecture method | Click Here |
DR.HANUMANTHARAJU | ZOOLOGY | BSC 1ST YEAR | IMPORTANT QUESTIONS | 0000-00-00 | 30 | 15 | 50 | 15 | 50 | Click Here | |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 0000-00-00 | 28 | 11 | 39 | 11 | 39 | Google meet lecture method with ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 0000-00-00 | 28 | 11 | 39 | 11 | 39 | Google meet lecture method with ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Mendel laws | 0000-00-00 | 28 | 11 | 39 | 11 | 39 | Google meet lecture method with ppt | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c2 | Cell biology, viruses | 0000-00-00 | 28 | 16 | 65 | 16 | 65 | Material shared through WhatsApp group and doubts clarified | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Genetics | 0000-00-00 | 38 | 24 | 77 | 24 | 77 | Google meet lecture method with ppt | Click Here |
D Uma | Botany | I MBC | Anamolous Secondary growth | 0000-00-00 | 25 | 8 | 32 | 8 | 32 | Zoom cloud meeting | Click Here |
Kuchipudisujatha | chemistry | II Bsc | D Block Elements | 0000-00-00 | 35 | 11 | 31.4 | 11 | 11 | lecture method have to use zoom app | Click Here |
DR.HANUMANTHARAJU | ZOOLOGY | BSC 1ST YEAR | DENTITION | 0000-00-00 | 30 | 10 | 33 | 10 | 33 | REMEDIAL CLASS | Click Here |
B.Swetha Rani Bai | bakery & confectionary | III B.Sc Home Science | Flours | 0000-00-00 | 23 | 15 | 60 | 15 | 60 | zoom web meetings | Click Here |
B.Swetha Rani Bai | Diet counselling | III B.Sc Home Science | needs of patient | 0000-00-00 | 23 | 16 | 60 | 16 | 60 | zoom meetings | Click Here |
Dr.B.D.J.Satya latha | ZOOLOGY | 2nd yr c1 | Mendel laws | 0000-00-00 | 38 | 24 | 65 | 24 | 65 | Google meet lecture method with ppt | Click Here |